BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026557
(237 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The
Nematophagous Fungus Clonostachys Rosea
pdb|3G6M|A Chain A, Crystal Structure Of A Chitinase Crchi1 From The
Nematophagous Fungus Clonostachys Rosea In Complex With
A Potent Inhibitor Caffeine
Length = 406
Score = 30.0 bits (66), Expect = 1.2, Method: Compositional matrix adjust.
Identities = 10/37 (27%), Positives = 20/37 (54%)
Query: 74 FQSLGSGSLKSPVWCHRIFPIQATCVLKEKELQATVS 110
+ ++G GS +S +W +++ P V+ + AT S
Sbjct: 290 YSTIGEGSWESGIWDYKVLPKAGATVITDSAAGATYS 326
>pdb|2LPM|A Chain A, Chemical Shift And Structure Assignments For Sma0114
Length = 123
Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust.
Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 3/36 (8%)
Query: 127 PVKFAVGYNRRGFEEKQNKIPKDTK---DSDVSALL 159
P FA GY +G + + + IP TK DS++ A+L
Sbjct: 81 PFIFATGYGSKGLDTRYSNIPLLTKPFLDSELEAVL 116
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.314 0.131 0.366
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,363,830
Number of Sequences: 62578
Number of extensions: 233618
Number of successful extensions: 394
Number of sequences better than 100.0: 18
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 382
Number of HSP's gapped (non-prelim): 18
length of query: 237
length of database: 14,973,337
effective HSP length: 96
effective length of query: 141
effective length of database: 8,965,849
effective search space: 1264184709
effective search space used: 1264184709
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)