Query         026591
Match_columns 236
No_of_seqs    129 out of 190
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:00:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026591.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026591hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04640 PLATZ:  PLATZ transcri 100.0 4.6E-38   1E-42  235.6   5.3   71   62-132     1-72  (72)
  2 PF00643 zf-B_box:  B-box zinc   96.6 0.00065 1.4E-08   44.6   0.5   37   22-61      5-42  (42)
  3 cd00021 BBOX B-Box-type zinc f  94.9   0.019 4.1E-07   36.5   1.9   36   22-60      2-38  (39)
  4 smart00336 BBOX B-Box-type zin  94.1    0.04 8.7E-07   35.4   2.2   35   22-59      5-40  (42)
  5 PF12855 Ecl1:  Life-span regul  86.6    0.14 3.1E-06   35.2  -0.8   28  109-136     6-36  (43)
  6 PF03884 DUF329:  Domain of unk  75.3    0.56 1.2E-05   34.1  -1.1   27  110-136     3-34  (57)
  7 PRK00418 DNA gyrase inhibitor;  74.0     1.4   3E-05   32.7   0.7   28  109-136     6-38  (62)
  8 COG3024 Uncharacterized protei  73.2       1 2.3E-05   33.7  -0.1   29  109-137     7-40  (65)
  9 PRK01343 zinc-binding protein;  63.1     2.9 6.4E-05   30.5   0.5   28  109-136     9-37  (57)
 10 PF10013 DUF2256:  Uncharacteri  61.8     2.7 5.8E-05   29.1   0.0   23  109-131     8-39  (42)
 11 PF09889 DUF2116:  Uncharacteri  60.9     2.7 5.8E-05   30.8  -0.1   31  110-140     4-34  (59)
 12 PF13240 zinc_ribbon_2:  zinc-r  59.4     4.5 9.8E-05   24.1   0.7   17  111-127     1-17  (23)
 13 PF02207 zf-UBR:  Putative zinc  52.9     7.4 0.00016   28.5   1.1   32   32-63     10-47  (71)
 14 PF01412 ArfGap:  Putative GTPa  50.2     2.4 5.3E-05   33.8  -2.0   49   32-81     10-72  (116)
 15 KOG2177 Predicted E3 ubiquitin  50.0     9.2  0.0002   31.6   1.4   38   22-63     88-127 (386)
 16 KOG4367 Predicted Zn-finger pr  46.3     6.8 0.00015   39.4   0.1   35   20-57    223-259 (699)
 17 PF13248 zf-ribbon_3:  zinc-rib  45.5      12 0.00025   22.7   1.0   18  110-127     3-20  (26)
 18 cd02340 ZZ_NBR1_like Zinc fing  38.1      15 0.00033   24.8   0.8   27   35-61     14-43  (43)
 19 PF06467 zf-FCS:  MYM-type Zinc  35.5     9.3  0.0002   24.8  -0.6   23  109-131     6-40  (43)
 20 COG4068 Uncharacterized protei  34.0      13 0.00028   27.7  -0.1   23  109-131     8-30  (64)
 21 COG4338 Uncharacterized protei  32.6       4 8.6E-05   29.3  -2.9   24  108-131    11-43  (54)
 22 KOG0703 Predicted GTPase-activ  31.2      14  0.0003   34.8  -0.4   49   34-83     24-86  (287)
 23 smart00105 ArfGap Putative GTP  29.3     8.7 0.00019   30.5  -1.8   42   34-76      2-57  (112)
 24 smart00396 ZnF_UBR1 Putative z  26.9      61  0.0013   24.0   2.5   29   30-58      8-42  (71)
 25 PF04438 zf-HIT:  HIT zinc fing  22.7      26 0.00057   22.1  -0.2   20  111-131     4-29  (30)
 26 PF12156 ATPase-cat_bd:  Putati  22.4      14 0.00031   28.4  -1.7   36  111-146     2-48  (88)
 27 PLN00209 ribosomal protein S27  21.6      91   0.002   24.7   2.6   58   53-132    21-85  (86)

No 1  
>PF04640 PLATZ:  PLATZ transcription factor;  InterPro: IPR006734 This family includes a conserved region in several uncharacterised plant proteins.
Probab=100.00  E-value=4.6e-38  Score=235.57  Aligned_cols=71  Identities=63%  Similarity=1.165  Sum_probs=69.9

Q ss_pred             EeccccceeeecccccccccCCccceEECCceEEEeecCCCCCC-CCCCCcccccccccCCCceeeeeeccc
Q 026591           62 RRYVYQDVIRLDDAAKLVDCDYVQPYINNGAKVIFLNQRPQSRT-RSSGNICSTCDRSLQDSYLFCCLSCKI  132 (236)
Q Consensus        62 RR~sY~dVVRv~DIqkl~D~S~IQtY~INsakVVFLn~RPq~r~-kg~~~~C~~C~R~L~d~~~FCSL~CKv  132 (236)
                      |||+||||||++||||+||||+||||+||++||||||+|||+++ |+.++.|++|+|+|+|+|+||||+|||
T Consensus         1 Rr~sY~dVVrv~di~kl~D~s~IQtY~iNs~kVVfLn~Rpq~~~~~~~~~~C~~C~R~L~d~~~fCSl~CKv   72 (72)
T PF04640_consen    1 RRYSYHDVVRVSDIQKLLDCSGIQTYVINSAKVVFLNPRPQSRPSKGSGNICETCHRSLQDPYRFCSLSCKV   72 (72)
T ss_pred             CcccccceEEHHHhHhhccccccEEEEeCCceEEEEccCCcCCCCCCCCCccCCCCCCCCCCCeEEeeeEEC
Confidence            79999999999999999999999999999999999999999999 999999999999999999999999997


No 2  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.61  E-value=0.00065  Score=44.64  Aligned_cols=37  Identities=32%  Similarity=0.815  Sum_probs=29.8

Q ss_pred             cCccCCCCCCCCCceeecccccccCCccccC-CCCCceeEE
Q 026591           22 GCIIHEEERKNEKNIYCLDCCTSLCPHCLSL-HGSHRLLQI   61 (236)
Q Consensus        22 ~C~~H~~~~knE~N~FCldC~~s~C~~C~~~-H~~HrvlQI   61 (236)
                      .|..|..   .+.++||.+|...+|..|... |.+|.++.|
T Consensus         5 ~C~~H~~---~~~~~~C~~C~~~~C~~C~~~~H~~H~~~~i   42 (42)
T PF00643_consen    5 KCPEHPE---EPLSLFCEDCNEPLCSECTVSGHKGHKIVPI   42 (42)
T ss_dssp             B-SSTTT---SBEEEEETTTTEEEEHHHHHTSTTTSEEEEC
T ss_pred             cCccCCc---cceEEEecCCCCccCccCCCCCCCCCEEeEC
Confidence            5888874   347999999999999999865 999987754


No 3  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=94.87  E-value=0.019  Score=36.48  Aligned_cols=36  Identities=28%  Similarity=0.524  Sum_probs=28.0

Q ss_pred             cCccCCCCCCCCCceeecccccccCCcccc-CCCCCceeE
Q 026591           22 GCIIHEEERKNEKNIYCLDCCTSLCPHCLS-LHGSHRLLQ   60 (236)
Q Consensus        22 ~C~~H~~~~knE~N~FCldC~~s~C~~C~~-~H~~HrvlQ   60 (236)
                      .|+.|..   +.-.+||.+|...+|..|.. .|++|.++.
T Consensus         2 ~C~~H~~---~~~~~fC~~~~~~iC~~C~~~~H~~H~~~~   38 (39)
T cd00021           2 LCDEHGE---EPLSLFCETDRALLCVDCDLSVHSGHRRVP   38 (39)
T ss_pred             CCCccCC---cceEEEeCccChhhhhhcChhhcCCCCEee
Confidence            4777753   23589999999999999964 588887654


No 4  
>smart00336 BBOX B-Box-type zinc finger.
Probab=94.13  E-value=0.04  Score=35.42  Aligned_cols=35  Identities=26%  Similarity=0.712  Sum_probs=27.8

Q ss_pred             cCccCCCCCCCCCceeecccccccCCccccC-CCCCcee
Q 026591           22 GCIIHEEERKNEKNIYCLDCCTSLCPHCLSL-HGSHRLL   59 (236)
Q Consensus        22 ~C~~H~~~~knE~N~FCldC~~s~C~~C~~~-H~~Hrvl   59 (236)
                      .|+.|..   ..-.+||-+|...+|..|... |++|+++
T Consensus         5 ~C~~h~~---~~~~~~C~~c~~~iC~~C~~~~H~~H~~~   40 (42)
T smart00336        5 KCDSHGD---EPAEFFCEECGALLCRTCDEAEHRGHTVV   40 (42)
T ss_pred             cCCCCCC---CceEEECCCCCcccccccChhhcCCCcee
Confidence            4777764   235899999999999999754 8889765


No 5  
>PF12855 Ecl1:  Life-span regulatory factor;  InterPro: IPR024368  The fungal proteins in this entry are involved in the regulation of chronological life-span [, ]. Overexpression of these proteins has been shown to extend the chronological life-span of wild-type strains. The mechanism by which this happens is not known, but microarray data suggests that they may function as pleiptropic stress regulators.
Probab=86.56  E-value=0.14  Score=35.20  Aligned_cols=28  Identities=25%  Similarity=0.787  Sum_probs=23.8

Q ss_pred             CCccccccccc---CCCceeeeeecccceEE
Q 026591          109 GNICSTCDRSL---QDSYLFCCLSCKIDYLI  136 (236)
Q Consensus       109 ~~~C~~C~R~L---~d~~~FCSL~CKv~~v~  136 (236)
                      .+.|.+|+|.+   .+...|||-.|++....
T Consensus         6 ~~yC~~Cdk~~~~~~~~~lYCSe~Cr~~D~~   36 (43)
T PF12855_consen    6 NDYCIVCDKQIDPPDDGSLYCSEECRLKDQE   36 (43)
T ss_pred             hhHHHHhhccccCCCCCccccCHHHHhHhhh
Confidence            35799999999   67899999999997644


No 6  
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=75.29  E-value=0.56  Score=34.14  Aligned_cols=27  Identities=26%  Similarity=0.609  Sum_probs=17.0

Q ss_pred             CcccccccccCC----Cce-eeeeecccceEE
Q 026591          110 NICSTCDRSLQD----SYL-FCCLSCKIDYLI  136 (236)
Q Consensus       110 ~~C~~C~R~L~d----~~~-FCSL~CKv~~v~  136 (236)
                      ..|-+|++...-    +|+ |||-.||+-.+.
T Consensus         3 v~CP~C~k~~~~~~~n~~rPFCS~RCk~iDLg   34 (57)
T PF03884_consen    3 VKCPICGKPVEWSPENPFRPFCSERCKLIDLG   34 (57)
T ss_dssp             EE-TTT--EEE-SSSSS--SSSSHHHHHHHHS
T ss_pred             ccCCCCCCeecccCCCCcCCcccHhhcccCHH
Confidence            468999998885    665 999999987543


No 7  
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=74.03  E-value=1.4  Score=32.66  Aligned_cols=28  Identities=25%  Similarity=0.657  Sum_probs=21.5

Q ss_pred             CCcccccccccC----CCc-eeeeeecccceEE
Q 026591          109 GNICSTCDRSLQ----DSY-LFCCLSCKIDYLI  136 (236)
Q Consensus       109 ~~~C~~C~R~L~----d~~-~FCSL~CKv~~v~  136 (236)
                      ...|-+|++...    .+| -|||-.||+-.+.
T Consensus         6 ~v~CP~C~k~~~w~~~~~~rPFCS~RCk~IDLg   38 (62)
T PRK00418          6 TVNCPTCGKPVEWGEISPFRPFCSKRCQLIDLG   38 (62)
T ss_pred             cccCCCCCCcccccCCCCcCCcccHHHHhhhHH
Confidence            457999999874    356 5999999987543


No 8  
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=73.23  E-value=1  Score=33.70  Aligned_cols=29  Identities=28%  Similarity=0.559  Sum_probs=22.5

Q ss_pred             CCcccccccccCC----Cc-eeeeeecccceEEe
Q 026591          109 GNICSTCDRSLQD----SY-LFCCLSCKIDYLIR  137 (236)
Q Consensus       109 ~~~C~~C~R~L~d----~~-~FCSL~CKv~~v~~  137 (236)
                      +..|-+|++...=    +| -|||-.||+-.+.+
T Consensus         7 ~v~CP~Cgkpv~w~~~s~frPFCSkRCklIDLg~   40 (65)
T COG3024           7 TVPCPTCGKPVVWGEESPFRPFCSKRCKLIDLGE   40 (65)
T ss_pred             cccCCCCCCcccccccCCcCcchhHhhhhcchhh
Confidence            4579999998874    55 59999999976543


No 9  
>PRK01343 zinc-binding protein; Provisional
Probab=63.14  E-value=2.9  Score=30.52  Aligned_cols=28  Identities=21%  Similarity=0.442  Sum_probs=22.3

Q ss_pred             CCcccccccccCCCc-eeeeeecccceEE
Q 026591          109 GNICSTCDRSLQDSY-LFCCLSCKIDYLI  136 (236)
Q Consensus       109 ~~~C~~C~R~L~d~~-~FCSL~CKv~~v~  136 (236)
                      ...|-+|++....++ -|||-.||.-.+.
T Consensus         9 ~~~CP~C~k~~~~~~rPFCS~RC~~iDLg   37 (57)
T PRK01343          9 TRPCPECGKPSTREAYPFCSERCRDIDLN   37 (57)
T ss_pred             CCcCCCCCCcCcCCCCcccCHHHhhhhHH
Confidence            468999999877654 7999999986533


No 10 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=61.80  E-value=2.7  Score=29.09  Aligned_cols=23  Identities=30%  Similarity=0.930  Sum_probs=19.7

Q ss_pred             CCcccccccccC---------CCceeeeeecc
Q 026591          109 GNICSTCDRSLQ---------DSYLFCCLSCK  131 (236)
Q Consensus       109 ~~~C~~C~R~L~---------d~~~FCSL~CK  131 (236)
                      ..+|.+|+|...         |.-.|||-.|.
T Consensus         8 ~K~C~~C~rpf~WRKKW~~~Wd~VkYCS~rCR   39 (42)
T PF10013_consen    8 SKICPVCGRPFTWRKKWARCWDEVKYCSDRCR   39 (42)
T ss_pred             CCcCcccCCcchHHHHHHHhchhhccHHHHhc
Confidence            458999999988         46899999996


No 11 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=60.95  E-value=2.7  Score=30.78  Aligned_cols=31  Identities=23%  Similarity=0.644  Sum_probs=26.3

Q ss_pred             CcccccccccCCCceeeeeecccceEEeccC
Q 026591          110 NICSTCDRSLQDSYLFCCLSCKIDYLIRIEG  140 (236)
Q Consensus       110 ~~C~~C~R~L~d~~~FCSL~CKv~~v~~~~~  140 (236)
                      .+|..||..+..+-.|||-.|+-+...++.+
T Consensus         4 kHC~~CG~~Ip~~~~fCS~~C~~~~~k~qk~   34 (59)
T PF09889_consen    4 KHCPVCGKPIPPDESFCSPKCREEYRKRQKR   34 (59)
T ss_pred             CcCCcCCCcCCcchhhhCHHHHHHHHHHHHH
Confidence            5899999999999999999999887665543


No 12 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=59.38  E-value=4.5  Score=24.13  Aligned_cols=17  Identities=29%  Similarity=0.856  Sum_probs=14.6

Q ss_pred             cccccccccCCCceeee
Q 026591          111 ICSTCDRSLQDSYLFCC  127 (236)
Q Consensus       111 ~C~~C~R~L~d~~~FCS  127 (236)
                      .|..|+..+.+...||+
T Consensus         1 ~Cp~CG~~~~~~~~fC~   17 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCP   17 (23)
T ss_pred             CCcccCCCCCCcCcchh
Confidence            37889999999999986


No 13 
>PF02207 zf-UBR:  Putative zinc finger in N-recognin (UBR box);  InterPro: IPR003126 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The N-end rule-based degradation signal, which targets a protein for ubiquitin-dependent proteolysis, comprises a destabilising amino-terminal residue and a specific internal lysine residue. This entry describes a putative zinc finger in N-recognin, a recognition component of the N-end rule pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0004842 ubiquitin-protein ligase activity, 0008270 zinc ion binding; PDB: 3NY1_B 3NIS_F 3NIM_A 3NIK_A 3NII_A 3NIH_A 3NIL_D 3NIN_B 3NIJ_A 3NIT_A ....
Probab=52.91  E-value=7.4  Score=28.54  Aligned_cols=32  Identities=28%  Similarity=0.693  Sum_probs=24.3

Q ss_pred             CCCceeeccccc----ccCCcc-cc-CCCCCceeEEEe
Q 026591           32 NEKNIYCLDCCT----SLCPHC-LS-LHGSHRLLQIRR   63 (236)
Q Consensus        32 nE~N~FCldC~~----s~C~~C-~~-~H~~HrvlQIRR   63 (236)
                      ++--..|++|..    .+|..| .. .|.+|++..++-
T Consensus        10 ~q~~y~C~tC~~~~~~~iC~~CF~~~~H~gH~~~~~~~   47 (71)
T PF02207_consen   10 GQIFYRCLTCSLDESSGICEECFANSCHEGHRVVYYRS   47 (71)
T ss_dssp             T-EEEEETTTBSSTT-BBEHHHHCTSGGGGSSEEEEE-
T ss_pred             CCEEEECccCCCCCCEEEchhhCCCCCcCCCcEEEEEe
Confidence            466788999985    599999 54 599999887754


No 14 
>PF01412 ArfGap:  Putative GTPase activating protein for Arf;  InterPro: IPR001164  This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins []. The GTP-bound form of ARF is essential for the maintenance of normal Golgi morphology, it participates in recruitment of coat proteins which are required for budding and fission of membranes. Before the fusion with an acceptor compartment the membrane must be uncoated. This step required the hydrolysis of GTP associated to ARF. These proteins contain a characteristic zinc finger motif (Cys-x2-Cys-x(16,17)-x2-Cys) which displays some similarity to the C4-type GATA zinc finger. The ARFGAP domain display no obvious similarity to other GAP proteins.  The 3D structure of the ARFGAP domain of the PYK2-associated protein beta has been solved []. It consists of a three-stranded beta-sheet surrounded by 5 alpha helices. The domain is organised around a central zinc atom which is coordinated by 4 cysteines. The ARFGAP domain is clearly unrelated to the other GAP proteins structures which are exclusively helical. Classical GAP proteins accelerate GTPase activity by supplying an arginine finger to the active site. The crystal structure of ARFGAP bound to ARF revealed that the ARFGAP domain does not supply an arginine to the active site which suggests a more indirect role of the ARFGAP domain in the GTPase hydrolysis []. The Rev protein of human immunodeficiency virus type 1 (HIV-1) facilitates nuclear export of unspliced and partly-spliced viral RNAs []. Rev contains an RNA-binding domain and an effector domain; the latter is believed to interact with a cellular cofactor required for the Rev response and hence HIV-1 replication. Human Rev interacting protein (hRIP) specifically interacts with the Rev effector. The amino acid sequence of hRIP is characterised by an N-terminal, C-4 class zinc finger motif.; GO: 0008060 ARF GTPase activator activity, 0008270 zinc ion binding, 0032312 regulation of ARF GTPase activity; PDB: 2P57_A 2CRR_A 2OWA_B 3O47_B 3DWD_A 1DCQ_A 2CRW_A 3MDB_D 3FEH_A 3LJU_X ....
Probab=50.18  E-value=2.4  Score=33.79  Aligned_cols=49  Identities=20%  Similarity=0.470  Sum_probs=29.7

Q ss_pred             CCCceeeccccc------------ccCCccccCCCC--CceeEEEeccccceeeeccccccccc
Q 026591           32 NEKNIYCLDCCT------------SLCPHCLSLHGS--HRLLQIRRYVYQDVIRLDDAAKLVDC   81 (236)
Q Consensus        32 nE~N~FCldC~~------------s~C~~C~~~H~~--HrvlQIRR~sY~dVVRv~DIqkl~D~   81 (236)
                      ...|..|.||.+            -+|..|...|+.  .++-+| |+.-.|-+..+||+.+...
T Consensus        10 ~~~N~~CaDCg~~~p~w~s~~~GiflC~~Cag~HR~lg~~is~V-kSi~~d~w~~~ev~~~~~~   72 (116)
T PF01412_consen   10 KPGNKVCADCGAPNPTWASLNYGIFLCLECAGIHRSLGVHISRV-KSITMDNWSPEEVQRMREG   72 (116)
T ss_dssp             STTCTB-TTT-SBS--EEETTTTEEE-HHHHHHHHHHTTTT--E-EETTTS---HHHHHHHHHS
T ss_pred             CcCcCcCCCCCCCCCCEEEeecChhhhHHHHHHHHHhcccchhc-cccccCCCCHHHHHHHHHH
Confidence            346999999963            189999888874  345555 7777888888888776544


No 15 
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=49.97  E-value=9.2  Score=31.62  Aligned_cols=38  Identities=29%  Similarity=0.552  Sum_probs=30.3

Q ss_pred             cCccCCCCCCCCCceeecccccccCCccc--cCCCCCceeEEEe
Q 026591           22 GCIIHEEERKNEKNIYCLDCCTSLCPHCL--SLHGSHRLLQIRR   63 (236)
Q Consensus        22 ~C~~H~~~~knE~N~FCldC~~s~C~~C~--~~H~~HrvlQIRR   63 (236)
                      .|..|...    ..+||..|...+|..|.  ..|..|+++.+..
T Consensus        88 ~c~~~~~~----~~~~c~~~~~~~c~~c~~~~~h~~h~~~~~~~  127 (386)
T KOG2177|consen   88 LCEKHGEE----LKLFCEEDEKLLCVLCRESGEHRGHPVLPLEE  127 (386)
T ss_pred             hhhhcCCc----ceEEecccccccCCCCCCcccccCCccccHHH
Confidence            56766543    68999999999999996  4699998877753


No 16 
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=46.29  E-value=6.8  Score=39.43  Aligned_cols=35  Identities=37%  Similarity=0.877  Sum_probs=27.8

Q ss_pred             cccCccCCCCCCCCCceeecccccccCCccccC--CCCCc
Q 026591           20 FNGCIIHEEERKNEKNIYCLDCCTSLCPHCLSL--HGSHR   57 (236)
Q Consensus        20 F~~C~~H~~~~knE~N~FCldC~~s~C~~C~~~--H~~Hr   57 (236)
                      -..|..|+..   ...|||+.|.-.+|..|+.+  |..|.
T Consensus       223 ~~~ct~h~~e---~~smyc~~ck~pvc~~clee~khs~he  259 (699)
T KOG4367|consen  223 VSTCTDHELE---NHSMYCVQCKMPVCYQCLEEGKHSSHE  259 (699)
T ss_pred             hhhccCCCCC---CceEEEEecCChHHHHHHHhhcccchh
Confidence            3468888753   25799999999999999975  77774


No 17 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=45.47  E-value=12  Score=22.67  Aligned_cols=18  Identities=22%  Similarity=0.685  Sum_probs=15.3

Q ss_pred             CcccccccccCCCceeee
Q 026591          110 NICSTCDRSLQDSYLFCC  127 (236)
Q Consensus       110 ~~C~~C~R~L~d~~~FCS  127 (236)
                      ..|..|+..+.+.++||+
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~   20 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCP   20 (26)
T ss_pred             CCCcccCCcCCcccccCh
Confidence            478899998888899996


No 18 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=38.13  E-value=15  Score=24.77  Aligned_cols=27  Identities=37%  Similarity=0.835  Sum_probs=19.5

Q ss_pred             ceeeccccc-ccCCcccc--CCCCCceeEE
Q 026591           35 NIYCLDCCT-SLCPHCLS--LHGSHRLLQI   61 (236)
Q Consensus        35 N~FCldC~~-s~C~~C~~--~H~~HrvlQI   61 (236)
                      -.-|+.|.. .+|..|..  .|..|+.++|
T Consensus        14 ry~C~~C~d~dLC~~C~~~~~H~~H~f~~~   43 (43)
T cd02340          14 RYKCLVCPDYDLCESCEAKGVHPEHAMLKI   43 (43)
T ss_pred             eEECCCCCCccchHHhhCcCCCCCCCEEeC
Confidence            356788865 79999954  4878887754


No 19 
>PF06467 zf-FCS:  MYM-type Zinc finger with FCS sequence motif;  InterPro: IPR010507 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  MYM-type zinc fingers were identified in MYM family proteins []. Human protein Q14202 from SWISSPROT is involved in a chromosomal translocation and may be responsible for X-linked retardation in XQ13.1 []. Q9UBW7 from SWISSPROT is also involved in disease. In myeloproliferative disorders it is fused to FGF receptor 1 []; in atypical myeloproliferative disorders it is rearranged []. Members of the family generally are involved in development. This Zn-finger domain functions as a transcriptional trans-activator of late vaccinia viral genes, and orthologues are also found in all nucleocytoplasmic large DNA viruses, NCLDV. This domain is also found fused to the C termini of recombinases from certain prokaryotic transposons []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2L8E_A 2DAS_A.
Probab=35.47  E-value=9.3  Score=24.76  Aligned_cols=23  Identities=30%  Similarity=0.745  Sum_probs=14.0

Q ss_pred             CCcccccccccCC-C-----------ceeeeeecc
Q 026591          109 GNICSTCDRSLQD-S-----------YLFCCLSCK  131 (236)
Q Consensus       109 ~~~C~~C~R~L~d-~-----------~~FCSL~CK  131 (236)
                      ...|..|++.+.. +           ..|||..|.
T Consensus         6 ~~~C~~C~~~~~~~~~~~~~~~~g~~~~FCS~~C~   40 (43)
T PF06467_consen    6 MKTCSYCKKYIPNKPTMIEVQYDGKMKQFCSQSCL   40 (43)
T ss_dssp             CEE-TTT--EEECCC----EE-TTTTSCCSSHHHH
T ss_pred             CCcCcccCCcccCCCccccccccCcccChhCHHHH
Confidence            4678888877743 2           379999885


No 20 
>COG4068 Uncharacterized protein containing a Zn-ribbon [Function unknown]
Probab=34.05  E-value=13  Score=27.71  Aligned_cols=23  Identities=17%  Similarity=0.583  Sum_probs=21.1

Q ss_pred             CCcccccccccCCCceeeeeecc
Q 026591          109 GNICSTCDRSLQDSYLFCCLSCK  131 (236)
Q Consensus       109 ~~~C~~C~R~L~d~~~FCSL~CK  131 (236)
                      ..+|..|+..+...-+|||-.|.
T Consensus         8 H~HC~VCg~aIp~de~~CSe~C~   30 (64)
T COG4068           8 HRHCVVCGKAIPPDEQVCSEECG   30 (64)
T ss_pred             CccccccCCcCCCccchHHHHHH
Confidence            35899999999999999999998


No 21 
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.65  E-value=4  Score=29.35  Aligned_cols=24  Identities=29%  Similarity=0.923  Sum_probs=20.5

Q ss_pred             CCCcccccccccC---------CCceeeeeecc
Q 026591          108 SGNICSTCDRSLQ---------DSYLFCCLSCK  131 (236)
Q Consensus       108 ~~~~C~~C~R~L~---------d~~~FCSL~CK  131 (236)
                      ...+|+.|+|...         |...|||-.|+
T Consensus        11 p~KICpvCqRPFsWRkKW~~cWDeVKyCSeRCr   43 (54)
T COG4338          11 PDKICPVCQRPFSWRKKWARCWDEVKYCSERCR   43 (54)
T ss_pred             chhhhhhhcCchHHHHHHHHHHHHHHHHHHHHH
Confidence            4579999999887         46789999998


No 22 
>KOG0703 consensus Predicted GTPase-activating protein [Signal transduction mechanisms]
Probab=31.20  E-value=14  Score=34.79  Aligned_cols=49  Identities=20%  Similarity=0.445  Sum_probs=37.2

Q ss_pred             Cceeecccccc------------cCCccccCCCC--CceeEEEeccccceeeecccccccccCC
Q 026591           34 KNIYCLDCCTS------------LCPHCLSLHGS--HRLLQIRRYVYQDVIRLDDAAKLVDCDY   83 (236)
Q Consensus        34 ~N~FCldC~~s------------~C~~C~~~H~~--HrvlQIRR~sY~dVVRv~DIqkl~D~S~   83 (236)
                      -|.+|.||.+.            +|-.|..-|+.  -+|-+| +++-.|-+.-++|+.++.+-+
T Consensus        24 ~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkV-kSv~LD~W~~eqv~~m~~~GN   86 (287)
T KOG0703|consen   24 DNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKV-KSVTLDEWTDEQVDFMISMGN   86 (287)
T ss_pred             ccCcccccCCCCCCeEEeecCeEEEeecccccccccchhhee-eeeeccccCHHHHHHHHHHcc
Confidence            39999999531            89999999985  467777 677788888788877765543


No 23 
>smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF. Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs.
Probab=29.30  E-value=8.7  Score=30.47  Aligned_cols=42  Identities=26%  Similarity=0.548  Sum_probs=27.3

Q ss_pred             Cceeecccccc------------cCCccccCCCCC--ceeEEEeccccceeeecccc
Q 026591           34 KNIYCLDCCTS------------LCPHCLSLHGSH--RLLQIRRYVYQDVIRLDDAA   76 (236)
Q Consensus        34 ~N~FCldC~~s------------~C~~C~~~H~~H--rvlQIRR~sY~dVVRv~DIq   76 (236)
                      -|..|.||...            +|..|..-|+..  ++-.| |+.-.|.+..++|+
T Consensus         2 ~N~~CaDC~~~~p~w~s~~~GifvC~~CsgiHR~lg~his~V-kSl~md~w~~~~i~   57 (112)
T smart00105        2 GNKKCFDCGAPNPTWASVNLGVFLCIECSGIHRSLGVHISKV-RSLTLDTWTEEELR   57 (112)
T ss_pred             CCCcccCCCCCCCCcEEeccceeEhHHhHHHHHhcCCCcCee-eecccCCCCHHHHH
Confidence            38899999641            799998888863  33334 45555655555553


No 24 
>smart00396 ZnF_UBR1 Putative zinc finger in N-recognin, a recognition component of the N-end rule pathway. Domain is involved in recognition of N-end rule substrates in yeast Ubr1p
Probab=26.92  E-value=61  Score=23.95  Aligned_cols=29  Identities=28%  Similarity=0.591  Sum_probs=22.5

Q ss_pred             CCCCCceeeccccc----ccCCcccc--CCCCCce
Q 026591           30 RKNEKNIYCLDCCT----SLCPHCLS--LHGSHRL   58 (236)
Q Consensus        30 ~knE~N~FCldC~~----s~C~~C~~--~H~~Hrv   58 (236)
                      .++|--..|++|..    .+|..|..  .|.+|++
T Consensus         8 ~~~~~~y~C~tC~~~~~~~iC~~Cf~~~~H~gH~~   42 (71)
T smart00396        8 TGGEVIYRCKTCGLDPTCVLCSDCFRSNCHKGHDY   42 (71)
T ss_pred             CCCCEEEECcCCCCCCCEeEChHHCCCCCCCCCCE
Confidence            45667788999974    58999966  5999983


No 25 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=22.70  E-value=26  Score=22.13  Aligned_cols=20  Identities=30%  Similarity=0.893  Sum_probs=12.1

Q ss_pred             cccccccccCC------Cceeeeeecc
Q 026591          111 ICSTCDRSLQD------SYLFCCLSCK  131 (236)
Q Consensus       111 ~C~~C~R~L~d------~~~FCSL~CK  131 (236)
                      .|.+|+. ...      ..+||||.|.
T Consensus         4 ~C~vC~~-~~kY~Cp~C~~~~CSl~C~   29 (30)
T PF04438_consen    4 LCSVCGN-PAKYRCPRCGARYCSLACY   29 (30)
T ss_dssp             EETSSSS-EESEE-TTT--EESSHHHH
T ss_pred             CCccCcC-CCEEECCCcCCceeCcEeE
Confidence            5666766 221      3579999884


No 26 
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=22.39  E-value=14  Score=28.37  Aligned_cols=36  Identities=28%  Similarity=0.780  Sum_probs=26.9

Q ss_pred             cccccccccCC-----------CceeeeeecccceEEeccCCccccc
Q 026591          111 ICSTCDRSLQD-----------SYLFCCLSCKIDYLIRIEGGLSKFF  146 (236)
Q Consensus       111 ~C~~C~R~L~d-----------~~~FCSL~CKv~~v~~~~~dls~~l  146 (236)
                      .|.+|+-.+.+           .-.||+-+|+-.+-+-++.+|.++-
T Consensus         2 ~C~HCg~~~p~~~~~~~~~~g~~~~FCC~GC~~V~~~i~~~gL~~yY   48 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKITVEIDGEERPFCCPGCQAVYQLIHENGLESYY   48 (88)
T ss_pred             CCCCCCCCCCCCCCeeeeeCCCccccccHHHHHHHHHHHHcchHHHH
Confidence            58889888841           2589999999876665667777654


No 27 
>PLN00209 ribosomal protein S27; Provisional
Probab=21.61  E-value=91  Score=24.66  Aligned_cols=58  Identities=24%  Similarity=0.387  Sum_probs=35.7

Q ss_pred             CCCCceeEEEeccccceeeecccccccccCCccceEECCceEEEeecCCCCCCCCCCCcccccccccCCC-------cee
Q 026591           53 HGSHRLLQIRRYVYQDVIRLDDAAKLVDCDYVQPYINNGAKVIFLNQRPQSRTRSSGNICSTCDRSLQDS-------YLF  125 (236)
Q Consensus        53 H~~HrvlQIRR~sY~dVVRv~DIqkl~D~S~IQtY~INsakVVFLn~RPq~r~kg~~~~C~~C~R~L~d~-------~~F  125 (236)
                      |...+++|-=++-+.||       |--||..||+-.-....+               ..|..|+..|..|       ..=
T Consensus        21 hK~k~Lv~~PnS~Fm~V-------kCp~C~n~q~VFShA~t~---------------V~C~~Cg~~L~~PTGGKa~l~~g   78 (86)
T PLN00209         21 HKLKRLVQSPNSFFMDV-------KCQGCFNITTVFSHSQTV---------------VVCGSCQTVLCQPTGGKARLTEG   78 (86)
T ss_pred             hhceeeecCCCCEEEEE-------ECCCCCCeeEEEecCceE---------------EEccccCCEeeccCCCCeEecCC
Confidence            55566777655555554       356788887644443333               3788999999764       234


Q ss_pred             eeeeccc
Q 026591          126 CCLSCKI  132 (236)
Q Consensus       126 CSL~CKv  132 (236)
                      ||+..|+
T Consensus        79 c~fr~k~   85 (86)
T PLN00209         79 CSFRKKG   85 (86)
T ss_pred             ceEEecC
Confidence            6665554


Done!