Citrus Sinensis ID: 026593

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MGSLLLREWAGFQQFPSATQNKLIELLSKLKQENVNTLTILVMGKGGVGKSSTVNSVIGERVVTVNSFQSEALRPVMVSRSKGGFTLNIIDTPGLVEAGYVNYQALELIKGFLLNKTIDVLLYADRLDAYRVDDLDRQIIKAVTGTFGKQIWRKSLLVLTHAQLCPPDGLNYDVYCSKRSDALLKTIRLGAGLGKHEFEDYAVPVALVENSGRCSKNENDEKVQFLCSHSVHTSHI
ccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEcccccccHHHHHHHHccccccccccccccCEEEEEEEEEccEEEEEEEccccccccccHHHHHHHHHHHHccccccEEEEEEEcccccccHHHHHHHHHHHHHHcHHHHccEEEEEccccccccccccHHHHHccccHHHHHHHHHHccccEEECccccccHHHHHcccccccccHHHHHHHHHccccccccc
****LLREWAGFQQFPSATQNKLIELLSKLKQENVNTLTILVMGKGGVGKSSTVNSVIGERVVTVNSFQSEALRPVMVSRSKGGFTLNIIDTPGLVEAGYVNYQALELIKGFLLNKTIDVLLYADRLDAYRVDDLDRQIIKAVTGTFGKQIWRKSLLVLTHAQLCPPDGLNYDVYCSKRSDALLKTIRLGAGLGKHEFEDYAVPVALVENSGRCSKNENDEKVQFLCSHSVHTS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSLLLREWAGFQQFPSATQNKLIELLSKLKQENVNTLTILVMGKGGVGKSSTVNSVIGERVVTVNSFQSEALRPVMVSRSKGGFTLNIIDTPGLVEAGYVNYQALELIKGFLLNKTIDVLLYADRLDAYRVDDLDRQIIKAVTGTFGKQIWRKSLLVLTHAQLCPPDGLNYDVYCSKRSDALLKTIRLGAGLGKHEFEDYAVPVALVENSGRCSKNENDEKVQFLCSHSVHTSHI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translocase of chloroplast 33, chloroplastic GTPase involved in protein precursor import into chloroplasts. Seems to recognize chloroplast-destined precursor proteins and regulate their presentation to the translocation channel through GTP hydrolysis. Binds GTP, GDP, XTP, but not ATP. Probably specialized in the import of nuclear encoded photosynthetic preproteins from the cytoplasm to the chloroplast, especially during early development stages.probableO23680

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DEF, chain A
Confidence level:very confident
Coverage over the Query: 7-232
View the alignment between query and template
View the model in PyMOL