Query         026596
Match_columns 236
No_of_seqs    35 out of 37
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:04:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026596.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026596hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01342 SAND:  SAND domain;  I  97.1 8.6E-05 1.9E-09   56.3  -0.6   55   29-96      8-67  (82)
  2 smart00258 SAND SAND domain.    95.9  0.0027 5.8E-08   48.3   0.7   56   32-96      3-58  (73)
  3 PF07496 zf-CW:  CW-type Zinc F  91.9    0.06 1.3E-06   37.2   0.6   47  136-187     1-48  (50)
  4 PF07897 DUF1675:  Protein of u  44.8      26 0.00055   32.7   3.5   49   32-84    221-273 (284)
  5 PF07610 DUF1573:  Protein of u  43.9      15 0.00033   24.5   1.5   28   31-60     16-43  (45)
  6 smart00134 LU Ly-6 antigen / u  34.3      19  0.0004   25.7   0.8   16  190-205    40-55  (79)
  7 PF14205 Cys_rich_KTR:  Cystein  34.3      15 0.00033   27.2   0.3   26  136-161     2-27  (55)
  8 PF07943 PBP5_C:  Penicillin-bi  32.1      49  0.0011   23.6   2.6   23   39-61     58-80  (91)
  9 COG4049 Uncharacterized protei  32.1      18 0.00039   27.5   0.4   14  136-149    15-28  (65)
 10 PF14901 Jiv90:  Cleavage induc  30.1      27 0.00057   28.1   1.1   33  139-171     6-46  (94)
 11 PF11101 DUF2884:  Protein of u  29.3      53  0.0012   28.8   2.9   21   98-118    36-59  (229)
 12 PF12800 Fer4_4:  4Fe-4S bindin  28.6      26 0.00057   19.8   0.6   11  200-210     1-11  (17)
 13 PF13333 rve_2:  Integrase core  27.7      28  0.0006   23.6   0.7   12   72-83     41-52  (52)
 14 PF12760 Zn_Tnp_IS1595:  Transp  27.5      31 0.00068   23.1   0.9   18  136-154    17-34  (46)
 15 PF04369 Lactococcin:  Lactococ  27.5      34 0.00073   25.8   1.1   20    6-25      2-21  (60)
 16 PF15389 DUF4612:  Domain of un  27.0      27 0.00058   29.0   0.6   25   37-61      1-31  (115)
 17 PF09832 DUF2059:  Uncharacteri  26.2      28 0.00062   24.0   0.5   13   13-25     16-28  (64)
 18 PF03293 Pox_RNA_pol:  Poxvirus  25.4      74  0.0016   27.9   3.0   34   30-63     66-102 (160)
 19 PF07244 Surf_Ag_VNR:  Surface   25.3      34 0.00074   23.3   0.8   22   10-31     10-32  (78)
 20 COG0227 RpmB Ribosomal protein  25.2      33 0.00072   26.6   0.8   27   80-106    19-50  (77)
 21 PF01927 Mut7-C:  Mut7-C RNAse   24.5      36 0.00077   27.6   0.9   13  134-146   120-132 (147)
 22 COG1281 Disulfide bond chapero  22.5      21 0.00045   33.4  -0.9   46   32-79    232-284 (286)
 23 cd00184 TNF Tumor Necrosis Fac  20.8      87  0.0019   24.6   2.4   21   41-63     32-52  (137)
 24 PF00751 DM:  DM DNA binding do  20.5      44 0.00096   23.6   0.6   16  216-231    23-38  (47)
 25 PF13986 DUF4224:  Domain of un  20.3      62  0.0013   22.4   1.3   16   13-28      2-17  (47)

No 1  
>PF01342 SAND:  SAND domain;  InterPro: IPR000770 The SAND domain (named after Sp100, AIRE-1, NucP41/75, DEAF-1) is a conserved ~80 residue region found in a number of nuclear proteins, many of which function in chromatin-dependent transcriptional control. These include proteins linked to various human diseases, such as the Sp100 (Speckled protein 100 kDa), NUDR (Nuclear DEAF-1 related), GMEB (Glucocorticoid Modulatory Element Binding) proteins and AIRE-1 (Autoimmune regulator 1) proteins.  Proteins containing the SAND domain have a modular structure; the SAND domain can be associated with a number of other modules, including the bromodomain, the PHD finger and the MYND finger. Because no SAND domain has been found in yeast, it is thought that the SAND domain could be restricted to animal phyla. Many SAND domain-containing proteins, including NUDR, DEAF-1 (Deformed epidermal autoregulatory factor-1) and GMEB, have been shown to bind DNA sequences specifically. The SAND domain has been proposed to mediate the DNA binding activity of these proteins [, ].  The resolution of the 3D structure of the SAND domain from Sp100b has revealed that it consists of a novel alpha/beta fold. The SAND domain adopts a compact fold consisting of a strongly twisted, five-stranded antiparallel beta-sheet with four alpha-helices packing against one side of the beta-sheet. The opposite side of the beta-sheet is solvent exposed. The beta-sheet and alpha-helical parts of the structure form two distinct regions. Multiple hydrophobic residues pack between these regions to form a structural core. A conserved KDWK sequence motif is found within the alpha-helical, positively charged surface patch. The DNA binding surface has been mapped to the alpha-helical region encompassing the KDWK motif [].; GO: 0003677 DNA binding, 0005634 nucleus; PDB: 1OQJ_B 1UFN_A 1H5P_A.
Probab=97.12  E-value=8.6e-05  Score=56.27  Aligned_cols=55  Identities=36%  Similarity=0.746  Sum_probs=36.9

Q ss_pred             CceEEEcccccceeecCcceeeEE--e-eCC--eeeEeeecCCCCCCCCCChhhhhhccccccccccccceEE
Q 026596           29 GDYIEVTCGCTSHRYGDAVGRLRV--F-SNG--DLEITCECTPGCNEDKMTPGAFEKHSGRETARKWKNNVWV   96 (236)
Q Consensus        29 edyvEV~CGcTs~rYGD~VGRLri--~-~~G--~~~ItCeC~PgC~~dkltp~aFEkHs~reta~kWkn~vWV   96 (236)
                      +.-|.|+||       +..|.|-.  + ..|  +-=|.++      ..-+||.+||+|+|++++.+||..|-|
T Consensus         8 ~~~lpVtCG-------~~~G~L~~~k~~~~g~~~kCI~~~------g~~~TP~eFE~~~G~~~sK~WK~SIr~   67 (82)
T PF01342_consen    8 DPELPVTCG-------DVKGTLYKKKFVKQGICGKCIQCE------GRWFTPSEFERHGGKGSSKDWKRSIRC   67 (82)
T ss_dssp             CSEEEEEET-------TEEEEEEHHHH-TTGTTSS-EEET------TEEE-HHHHHHHHTTCTCS-HHHHSEE
T ss_pred             CCeEeeEeC-------CeEEEEEHHHhhcccccCceEeeC------CcEECHHHHHhhcCcccCCCCCccEEE
Confidence            567999996       44555542  2 222  1123222      567999999999999999999999998


No 2  
>smart00258 SAND SAND domain.
Probab=95.93  E-value=0.0027  Score=48.32  Aligned_cols=56  Identities=27%  Similarity=0.503  Sum_probs=38.3

Q ss_pred             EEEcccccceeecCcceeeEEeeCCeeeEeeecCCCCCCCCCChhhhhhccccccccccccceEE
Q 026596           32 IEVTCGCTSHRYGDAVGRLRVFSNGDLEITCECTPGCNEDKMTPGAFEKHSGRETARKWKNNVWV   96 (236)
Q Consensus        32 vEV~CGcTs~rYGD~VGRLri~~~G~~~ItCeC~PgC~~dkltp~aFEkHs~reta~kWkn~vWV   96 (236)
                      |.|+||-       .-|.|-..--++ -|.+-|+-- ...=+||.+||+++|++++.+||..|=+
T Consensus         3 lpV~CG~-------~~g~L~~~kf~~-G~~~kCI~~-~~~~~TP~eFe~~~g~~~~K~WK~sIR~   58 (73)
T smart00258        3 LPVTCGT-------VKGILYKKKFKC-GISVKCIQY-EDKWFTPKEFEIEGGKGKSKDWKRSIRC   58 (73)
T ss_pred             cceeeCC-------eeeeeeHhhhhc-CcccCCccC-CCEEEChHHHHhhcCCcccCCcchheeE
Confidence            5678864       445554333222 355666532 4456899999999999999999998754


No 3  
>PF07496 zf-CW:  CW-type Zinc Finger;  InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a CW-type zinc finger motif, named for its conserved cysteine and tryptophan residues. It is predicted to be a highly specialised mononuclear four-cysteine (C4) zinc finger that plays a role in DNA binding and/or promoting protein-protein interactions in complicated eukaryotic processes including chromatin methylation status and early embryonic development. Weak homology to members of IPR001965 from INTERPRO further evidences these predictions. The domain is found exclusively in vertebrates, vertebrate-infecting parasites and higher plants [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2RR4_A 2E61_A 2L7P_A.
Probab=91.91  E-value=0.06  Score=37.21  Aligned_cols=47  Identities=36%  Similarity=0.587  Sum_probs=22.0

Q ss_pred             cceeeeccccccccccccChhHHhhhhhhhcCCCcccCCCC-CCccccCcHHH
Q 026596          136 DEFVRCARCNKERRFRLRTKEECLIHHNALADKNWKCSDLP-YDKITCDDEEE  187 (236)
Q Consensus       136 DEFvrCt~CgKeRRFrLrsk~ecr~yHdAl~~~~WtCsd~p-y~kitCdDdEE  187 (236)
                      |.+|.|.+|+|=|+.....-+..    +.+.+ .|+|++-| ...-+|+..||
T Consensus         1 ~~WVQCd~C~KWR~lp~~~~~~~----~~~~d-~W~C~~n~~~~~~sC~~pee   48 (50)
T PF07496_consen    1 DYWVQCDSCLKWRRLPEEVDPIR----EELPD-PWYCSMNPDPPFNSCDAPEE   48 (50)
T ss_dssp             -EEEE-TTT--EEEE-CCHHCTS----CCSST-T--GGGSS-CCC-STTS--S
T ss_pred             CeEEECCCCCceeeCChhhCccc----ccCCC-eEEcCCCCCCCCCCCCCccc
Confidence            56899999999999762111100    12233 89999976 23366877665


No 4  
>PF07897 DUF1675:  Protein of unknown function (DUF1675);  InterPro: IPR012463 The members of this family are sequences derived from hypothetical plant proteins of unknown function. One member of this family (Q9SFV5 from SWISSPROT) is annotated as a putative RNA-binding protein, but no evidence was found to support this. 
Probab=44.85  E-value=26  Score=32.68  Aligned_cols=49  Identities=27%  Similarity=0.575  Sum_probs=34.0

Q ss_pred             EEEcccccce--eecC-cceeeEEe-eCCeeeEeeecCCCCCCCCCChhhhhhcccc
Q 026596           32 IEVTCGCTSH--RYGD-AVGRLRVF-SNGDLEITCECTPGCNEDKMTPGAFEKHSGR   84 (236)
Q Consensus        32 vEV~CGcTs~--rYGD-~VGRLri~-~~G~~~ItCeC~PgC~~dkltp~aFEkHs~r   84 (236)
                      -++.|-.|.-  -.|- .-|=|-=| ..+|+-|-|-|    +..-|||+.|=||+|.
T Consensus       221 ~~mp~v~t~g~gpng~~i~g~ly~y~~~~~v~i~c~c----hg~~~~~~efv~h~~~  273 (284)
T PF07897_consen  221 EDMPCVSTTGDGPNGKRIEGFLYKYGKGEEVRIVCVC----HGSFLSPAEFVKHAGG  273 (284)
T ss_pred             ccCCceeeccCCCCCceeeEEEEEecCCCeEEEEEEe----cCCCCCHHHHHHhcCC
Confidence            4556655532  1232 23566666 56799999986    6778999999999985


No 5  
>PF07610 DUF1573:  Protein of unknown function (DUF1573);  InterPro: IPR011467 These hypothetical proteins from bacteria, such as Rhodopirellula baltica, Bacteroides thetaiotaomicron and Porphyromonas gingivalis, share a region of conserved sequence towards their N termini.
Probab=43.93  E-value=15  Score=24.52  Aligned_cols=28  Identities=21%  Similarity=0.640  Sum_probs=18.5

Q ss_pred             eEEEcccccceeecCcceeeEEeeCCeeeE
Q 026596           31 YIEVTCGCTSHRYGDAVGRLRVFSNGDLEI   60 (236)
Q Consensus        31 yvEV~CGcTs~rYGD~VGRLri~~~G~~~I   60 (236)
                      -|+..||||...|....  |.-..+|++.+
T Consensus        16 ~v~tsCgCt~~~~~~~~--i~PGes~~i~v   43 (45)
T PF07610_consen   16 DVQTSCGCTTAEYSKKP--IAPGESGKIKV   43 (45)
T ss_pred             EeeEccCCEEeeCCcce--ECCCCEEEEEE
Confidence            45679999999998843  44444444443


No 6  
>smart00134 LU Ly-6 antigen / uPA receptor -like domain. Three-fold repeated domain in urokinase-type plasminogen activator receptor; occurs singly in other GPI-linked cell-surface glycoproteins (Ly-6 family, CD59, thymocyte B cell antigen, Sgp-2). Topology of these domains is similar to that of snake venom neurotoxins.
Probab=34.32  E-value=19  Score=25.68  Aligned_cols=16  Identities=50%  Similarity=1.163  Sum_probs=13.7

Q ss_pred             hhhhhcCCCCCCCCCC
Q 026596          190 SRRVYRGCIRSPTCKG  205 (236)
Q Consensus       190 S~k~~RGCsrSstC~G  205 (236)
                      ..+++|||+++++|+.
T Consensus        40 ~~~~~rgC~~~~~Cp~   55 (79)
T smart00134       40 GSVVYKGCATSPICPG   55 (79)
T ss_pred             CceEEcCccCCCCCCC
Confidence            4669999999999974


No 7  
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=34.31  E-value=15  Score=27.23  Aligned_cols=26  Identities=19%  Similarity=0.520  Sum_probs=20.5

Q ss_pred             cceeeeccccccccccccChhHHhhh
Q 026596          136 DEFVRCARCNKERRFRLRTKEECLIH  161 (236)
Q Consensus       136 DEFvrCt~CgKeRRFrLrsk~ecr~y  161 (236)
                      ++|+.|..||.-.|-++|.--+.+|+
T Consensus         2 ~~Wi~CP~CgnKTR~kir~DT~LkNf   27 (55)
T PF14205_consen    2 SEWILCPICGNKTRLKIREDTVLKNF   27 (55)
T ss_pred             CeEEECCCCCCccceeeecCceeccc
Confidence            68999999999888888765555544


No 8  
>PF07943 PBP5_C:  Penicillin-binding protein 5, C-terminal domain;  InterPro: IPR012907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This entry contains proteins that are annotated as penicillin-binding protein 5 and 6. These belong to MEROPS peptidase family S11 (D-Ala-D-Ala carboxypeptidase A family, clan SE). Penicillin-binding protein 5 expressed by Escherichia coli functions as a D-alanyl-D-alanine carboxypeptidase. It is composed of two domains that are oriented at approximately right angles to each other. The N-terminal domain (IPR001967 from INTERPRO) is the catalytic domain. The C-terminal domain, this entry, is organised into a sandwich of two anti-parallel beta-sheets, and has a relatively hydrophobic surface as compared to the N-terminal domain. Its precise function is unknown; it may mediate interactions with other cell wall-synthesising enzymes, thus allowing the protein to be recruited to areas of active cell wall synthesis. It may also function as a linker domain that positions the active site in the catalytic domain closer to the peptidoglycan layer, to allow it to interact with cell wall peptides []. ; GO: 0009002 serine-type D-Ala-D-Ala carboxypeptidase activity, 0006508 proteolysis; PDB: 3A3J_A 3MFD_B 1XP4_D 3MZD_A 1NZU_A 1NJ4_A 1Z6F_A 3MZF_A 1NZO_A 3MZE_A ....
Probab=32.07  E-value=49  Score=23.58  Aligned_cols=23  Identities=30%  Similarity=0.479  Sum_probs=18.5

Q ss_pred             cceeecCcceeeEEeeCCeeeEe
Q 026596           39 TSHRYGDAVGRLRVFSNGDLEIT   61 (236)
Q Consensus        39 Ts~rYGD~VGRLri~~~G~~~It   61 (236)
                      ..-+=|+-||.|.|+.+|++..+
T Consensus        58 aPi~kG~~vG~~~v~~~~~~i~~   80 (91)
T PF07943_consen   58 APIKKGQVVGTLTVYLDGKLIGE   80 (91)
T ss_dssp             SGBGTTSEEEEEEEEETTEEEEE
T ss_pred             CcccCCCEEEEEEEEECCEEEEE
Confidence            34567999999999999987544


No 9  
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=32.07  E-value=18  Score=27.55  Aligned_cols=14  Identities=50%  Similarity=1.103  Sum_probs=12.2

Q ss_pred             cceeeecccccccc
Q 026596          136 DEFVRCARCNKERR  149 (236)
Q Consensus       136 DEFvrCt~CgKeRR  149 (236)
                      .+|++|.+||+-=|
T Consensus        15 E~~lrCPRC~~~FR   28 (65)
T COG4049          15 EEFLRCPRCGMVFR   28 (65)
T ss_pred             ceeeeCCchhHHHH
Confidence            58999999999765


No 10 
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=30.13  E-value=27  Score=28.09  Aligned_cols=33  Identities=30%  Similarity=0.798  Sum_probs=26.2

Q ss_pred             eeecccc-ccccccccCh-------hHHhhhhhhhcCCCcc
Q 026596          139 VRCARCN-KERRFRLRTK-------EECLIHHNALADKNWK  171 (236)
Q Consensus       139 vrCt~Cg-KeRRFrLrsk-------~ecr~yHdAl~~~~Wt  171 (236)
                      ++|++|| +-+||..+..       .+|+++|-|-.+.-|-
T Consensus         6 i~C~~C~~~H~r~~t~r~~~~AR~C~~C~~~H~Ak~gDiWa   46 (94)
T PF14901_consen    6 IRCDKCGGKHKRIETDRPPSAARYCQDCKIRHPAKEGDIWA   46 (94)
T ss_pred             eechhhCCeeeeEEecCchhhhHhHHHhhhhcccccCCeEE
Confidence            6788885 5677777655       4999999999998885


No 11 
>PF11101 DUF2884:  Protein of unknown function (DUF2884);  InterPro: IPR021307  Some members in this bacterial family of proteins are annotated as YggN which currently has no known function. 
Probab=29.31  E-value=53  Score=28.79  Aligned_cols=21  Identities=33%  Similarity=0.518  Sum_probs=15.6

Q ss_pred             eCCcccccc---hhhHHHHhhhhh
Q 026596           98 ANGEKVPLS---KTVLLKYYNQAS  118 (236)
Q Consensus        98 ~~~~kvpL~---kT~LlkyY~~~~  118 (236)
                      |+|++|+|+   +..|..|+....
T Consensus        36 i~G~~v~L~~~Q~q~l~~Y~~~lr   59 (229)
T PF11101_consen   36 INGKKVSLNAEQQQALQQYQQGLR   59 (229)
T ss_pred             ECCEEccCCHHHHHHHHHHHHHHH
Confidence            488889887   567888887543


No 12 
>PF12800 Fer4_4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1BD6_A 1BQX_A 1BWE_A 1BC6_A.
Probab=28.62  E-value=26  Score=19.76  Aligned_cols=11  Identities=55%  Similarity=1.301  Sum_probs=7.0

Q ss_pred             CCCCCCCCcee
Q 026596          200 SPTCKGCTSCV  210 (236)
Q Consensus       200 SstC~GCstCv  210 (236)
                      |..|.||..|+
T Consensus         1 ~~~C~~C~~C~   11 (17)
T PF12800_consen    1 QERCIGCGSCV   11 (17)
T ss_dssp             -CCCTTSSSST
T ss_pred             CCcCCCCchHH
Confidence            35677777765


No 13 
>PF13333 rve_2:  Integrase core domain
Probab=27.74  E-value=28  Score=23.65  Aligned_cols=12  Identities=8%  Similarity=0.243  Sum_probs=10.3

Q ss_pred             CCChhhhhhccc
Q 026596           72 KMTPGAFEKHSG   83 (236)
Q Consensus        72 kltp~aFEkHs~   83 (236)
                      .|||.+|++|+.
T Consensus        41 ~lsP~eyr~~~l   52 (52)
T PF13333_consen   41 GLSPVEYRNQYL   52 (52)
T ss_pred             CcCHHHHHHhhC
Confidence            699999999863


No 14 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=27.49  E-value=31  Score=23.10  Aligned_cols=18  Identities=44%  Similarity=1.126  Sum_probs=14.6

Q ss_pred             cceeeeccccccccccccC
Q 026596          136 DEFVRCARCNKERRFRLRT  154 (236)
Q Consensus       136 DEFvrCt~CgKeRRFrLrs  154 (236)
                      |.|+ |..||...-++|++
T Consensus        17 ~g~~-CP~Cg~~~~~~~~~   34 (46)
T PF12760_consen   17 DGFV-CPHCGSTKHYRLKT   34 (46)
T ss_pred             CCCC-CCCCCCeeeEEeCC
Confidence            4566 99999988888877


No 15 
>PF04369 Lactococcin:  Lactococcin-like family;  InterPro: IPR007464 Bacteriocins are produced by bacteria to inhibit the growth of similar or closely related bacterial strains. The class II bacteriocins are small heat-stable proteins for which disulphide bonds are the only modification to the peptide. Lactococcin A and B are class-IId bacteriocins (one-peptide non-pediocin-like bacteriocin) [, ].; GO: 0042742 defense response to bacterium, 0005576 extracellular region
Probab=27.48  E-value=34  Score=25.79  Aligned_cols=20  Identities=40%  Similarity=0.557  Sum_probs=14.9

Q ss_pred             cccccccccChHhHhhhhcc
Q 026596            6 EKESVLMMFSDEELREISGV   25 (236)
Q Consensus         6 ~~~~g~~LF~eEELr~i~gv   25 (236)
                      ++..-....|+|||.+|.|=
T Consensus         2 ~~~~nf~~~sdeeL~~i~GG   21 (60)
T PF04369_consen    2 ENQLNFNILSDEELSKINGG   21 (60)
T ss_pred             cccccceecCHHHHhhccCC
Confidence            44444567899999999874


No 16 
>PF15389 DUF4612:  Domain of unknown function (DUF4612)
Probab=26.95  E-value=27  Score=29.02  Aligned_cols=25  Identities=48%  Similarity=0.624  Sum_probs=23.0

Q ss_pred             cccceeecCcc------eeeEEeeCCeeeEe
Q 026596           37 GCTSHRYGDAV------GRLRVFSNGDLEIT   61 (236)
Q Consensus        37 GcTs~rYGD~V------GRLri~~~G~~~It   61 (236)
                      ||||.+-++||      |+.+.+++|++++.
T Consensus         1 GC~sak~~~~v~~~e~~~~~k~~sn~D~~~d   31 (115)
T PF15389_consen    1 GCTSAKQVSAVPNDEEGGNGKAHSNGDLFSD   31 (115)
T ss_pred             CccccccccccCcchhhcccccccccccccc
Confidence            89999999998      89999999999876


No 17 
>PF09832 DUF2059:  Uncharacterized protein conserved in bacteria (DUF2059);  InterPro: IPR018637  This entry contains proteins that have no known function. ; PDB: 2X3O_B 3OAO_A.
Probab=26.18  E-value=28  Score=24.01  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=10.6

Q ss_pred             ccChHhHhhhhcc
Q 026596           13 MFSDEELREISGV   25 (236)
Q Consensus        13 LF~eEELr~i~gv   25 (236)
                      -|+++||+.|..|
T Consensus        16 ~ft~~El~~i~~F   28 (64)
T PF09832_consen   16 HFTEEELDAILAF   28 (64)
T ss_dssp             HS-HHHHHHHHHH
T ss_pred             HCCHHHHHHHHHH
Confidence            6999999999876


No 18 
>PF03293 Pox_RNA_pol:  Poxvirus DNA-directed RNA polymerase, 18 kD subunit;  InterPro: IPR004973 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The Poxvirus DNA-directed RNA polymerase (2.7.7.6 from EC) catalyses DNA-template-directed extension of the 3'-end of an RNA strand by one nucleotide at a time. The enzyme consists of at least eight subunits, this is the 18 kDa subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0019083 viral transcription
Probab=25.38  E-value=74  Score=27.91  Aligned_cols=34  Identities=29%  Similarity=0.659  Sum_probs=28.5

Q ss_pred             ceEEEcccccceee--cCcc-eeeEEeeCCeeeEeee
Q 026596           30 DYIEVTCGCTSHRY--GDAV-GRLRVFSNGDLEITCE   63 (236)
Q Consensus        30 dyvEV~CGcTs~rY--GD~V-GRLri~~~G~~~ItCe   63 (236)
                      --|-|+|--|-+.|  ||-| |.|-|..+-...|.|-
T Consensus        66 ivv~VPC~vtykyYk~GDvV~GtLnIedESni~V~Cg  102 (160)
T PF03293_consen   66 IVVKVPCNVTYKYYKVGDVVRGTLNIEDESNITVQCG  102 (160)
T ss_pred             EEEEeeeEEEEEEEeeCCEEEEEEEecccCceEEEcC
Confidence            35778999999877  9987 8999999988888774


No 19 
>PF07244 Surf_Ag_VNR:  Surface antigen variable number repeat;  InterPro: IPR010827 This motif is found primarily in bacterial surface antigens, normally as variable number repeats at the N terminus. The C terminus of these proteins is normally represented by IPR000184 from INTERPRO. There may also be a relationship to haemolysin activator HlyB (IPR005565 from INTERPRO). The alignment centres on a -GY- or -GF- motif. Some members of this family are found in the mitochondria. It is predicted to have a mixed alpha/beta secondary structure.; GO: 0019867 outer membrane; PDB: 2X8X_X 3MC8_A 3OG5_A 3MC9_B 2QCZ_B 3EFC_A 3Q6B_A 2QDF_A 2V9H_A.
Probab=25.34  E-value=34  Score=23.25  Aligned_cols=22  Identities=45%  Similarity=0.578  Sum_probs=17.3

Q ss_pred             cc-cccChHhHhhhhcceecCce
Q 026596           10 VL-MMFSDEELREISGVKRGGDY   31 (236)
Q Consensus        10 g~-~LF~eEELr~i~gvk~Gedy   31 (236)
                      |. ..|++++|+..++++.|+-|
T Consensus        10 Gn~~~~~~~~l~~~l~~~~G~~~   32 (78)
T PF07244_consen   10 GNLKKFSDEELRRELGLKPGDPF   32 (78)
T ss_dssp             SE-SSSHHHHHHHCHSS-TTSBE
T ss_pred             cCceEeCHHHHHhhcCCCCCCEe
Confidence            53 68999999998899999765


No 20 
>COG0227 RpmB Ribosomal protein L28 [Translation, ribosomal structure and biogenesis]
Probab=25.16  E-value=33  Score=26.64  Aligned_cols=27  Identities=30%  Similarity=0.597  Sum_probs=22.1

Q ss_pred             hccccccccccccce-----EEEeCCcccccc
Q 026596           80 KHSGRETARKWKNNV-----WVIANGEKVPLS  106 (236)
Q Consensus        80 kHs~reta~kWkn~v-----WV~~~~~kvpL~  106 (236)
                      .||.+-|.++|.-|+     |+.++|..+-|+
T Consensus        19 Shs~~kTkRr~~pNlq~~~~~~~~~g~~~~l~   50 (77)
T COG0227          19 SHSHNKTKRRFLPNLQKVRFWSLSDGRFKRLR   50 (77)
T ss_pred             cccccccceeecCccEEEEEEEccCCcEEEEE
Confidence            599999999999885     788888776664


No 21 
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=24.53  E-value=36  Score=27.58  Aligned_cols=13  Identities=54%  Similarity=1.055  Sum_probs=11.1

Q ss_pred             cccceeeeccccc
Q 026596          134 HRDEFVRCARCNK  146 (236)
Q Consensus       134 HRDEFvrCt~CgK  146 (236)
                      +-++|-+|++|||
T Consensus       120 ~~~~f~~C~~C~k  132 (147)
T PF01927_consen  120 TYDEFWRCPGCGK  132 (147)
T ss_pred             cCCeEEECCCCCC
Confidence            4477999999998


No 22 
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=22.50  E-value=21  Score=33.35  Aligned_cols=46  Identities=26%  Similarity=0.504  Sum_probs=30.1

Q ss_pred             EEEcccccceeecCcceeeE-------EeeCCeeeEeeecCCCCCCCCCChhhhh
Q 026596           32 IEVTCGCTSHRYGDAVGRLR-------VFSNGDLEITCECTPGCNEDKMTPGAFE   79 (236)
Q Consensus        32 vEV~CGcTs~rYGD~VGRLr-------i~~~G~~~ItCeC~PgC~~dkltp~aFE   79 (236)
                      |+.-|.|+--|.+++.=.|-       |..+|..+|+|+.|-.  .-.+++..+|
T Consensus       232 v~f~C~CSrEr~~~aL~~lg~eEi~~m~eedg~iev~C~FC~~--~Y~f~~~ei~  284 (286)
T COG1281         232 VEFRCSCSRERVAAALLSLGKEELEDMLEEDGGIEVTCEFCGT--KYLFDEEEIE  284 (286)
T ss_pred             ceEEcCCCHHHHHHHHHhcCHHHHHHHHhcCCCeEEEeeccCC--EEecCHHHHh
Confidence            77788888888887765542       3446788888887754  2334444443


No 23 
>cd00184 TNF Tumor Necrosis Factor; TNF superfamily members include the cytokines: TNF (TNF-alpha), LT (lymphotoxin-alpha, TNF-beta), CD40 ligand, Apo2L (TRAIL), Fas ligand, and osteoprotegerin (OPG) ligand. These proteins generally have an intracellular N-terminal domain, a short transmembrane segment, an extracellular stalk, and a globular TNF-like extracellular domain of about 150 residues. They initiate apoptosis by binding to related receptors, some of which have intracellular death domains. They generally form homo- or hetero- trimeric complexes.TNF cytokines bind one elongated receptor molecule along each of three clefts formed by neighboring monomers of the trimer with ligand trimerization a requiste for receptor binding.
Probab=20.81  E-value=87  Score=24.64  Aligned_cols=21  Identities=24%  Similarity=0.232  Sum_probs=18.4

Q ss_pred             eeecCcceeeEEeeCCeeeEeee
Q 026596           41 HRYGDAVGRLRVFSNGDLEITCE   63 (236)
Q Consensus        41 ~rYGD~VGRLri~~~G~~~ItCe   63 (236)
                      -+|=|  |+|.|..+|.|+|.+.
T Consensus        32 ~~~~~--g~L~V~~~GlY~VYsQ   52 (137)
T cd00184          32 LELQN--GELVVPQDGLYYIYSQ   52 (137)
T ss_pred             eEEEC--CEEEecCCcEEEEEEE
Confidence            56666  9999999999999986


No 24 
>PF00751 DM:  DM DNA binding domain;  InterPro: IPR001275 This domain was first discovered in the doublesex proteins of Drosophila melanogaster and is also seen in proteins from Caenorhabditis elegans []. In D. melanogaster the doublesex gene controls somatic sexual differentiation by producing alternatively spliced mRNAs encoding related sex-specific polypeptides []. These proteins are believed to function as transcription factors on downstream sex-determination genes, especially on neuroblast differentiation and yolk protein genes transcription [, ]. The DM domain binds DNA as a dimer, allowing the recognition of pseudopalindromic sequences [, , ]. The NMR analysis of the DSX DM domain [] revealed a novel zinc module containing 'intertwined' CCHC and HCCC zinc-binding sites. The recognition of the DNA requires the carboxy-terminal basic tail which contacts the minor groove of the target sequence.; GO: 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent, 0007548 sex differentiation, 0005634 nucleus; PDB: 1LPV_A.
Probab=20.48  E-value=44  Score=23.61  Aligned_cols=16  Identities=38%  Similarity=1.121  Sum_probs=10.9

Q ss_pred             eeeeccCCchhhhhhh
Q 026596          216 ICRFSDCSCQTCIDFT  231 (236)
Q Consensus       216 ~CRF~DC~CQtC~Df~  231 (236)
                      .|+|.+|.|..|.-+.
T Consensus        23 ~C~~~~C~C~kC~li~   38 (47)
T PF00751_consen   23 YCPFRDCQCDKCALIA   38 (47)
T ss_dssp             G-TTTT--SHHHHHHH
T ss_pred             ccCcCCCcCCCCcCcH
Confidence            4899999999998664


No 25 
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=20.30  E-value=62  Score=22.44  Aligned_cols=16  Identities=50%  Similarity=0.879  Sum_probs=13.5

Q ss_pred             ccChHhHhhhhcceec
Q 026596           13 MFSDEELREISGVKRG   28 (236)
Q Consensus        13 LF~eEELr~i~gvk~G   28 (236)
                      +.++|||.+|-|.|+-
T Consensus         2 fLT~~El~elTG~k~~   17 (47)
T PF13986_consen    2 FLTDEELQELTGYKRP   17 (47)
T ss_pred             CCCHHHHHHHHCCCCH
Confidence            6789999999998853


Done!