Citrus Sinensis ID: 026614

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------

MVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQKANGTAKVGGGEDAE

cHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccccccccccc

MVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSS*************AKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTS*************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERAxxxxxxxxxxxxxxxxxxxxxSYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQKANGTAKVGGGEDAE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
14-3-3-like protein D		confident	Q96453
14-3-3 protein epsilon	Positively regulates Ras-mediated pathways. Acts downstream or parallel to Raf, but upstream of nuclear factors in Ras signaling. Three mutants have been isolated, that suppress the rough eye phenotype caused by mutated Ras1 (sev-Ras1 v12). Inhibits yki activity by restricting its nuclear localization.	confident	P92177
14-3-3 protein epsilon	Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.	confident	Q5ZMT0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UZD, chain A
Confidence level:very confident
Coverage over the Query: 1-210
View the alignment between query and template
View the model in PyMOL