BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026616
(236 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2ORE|D Chain D, Binary Structure Of Escherichia Coli Dna Adenine
Methyltransferase And S-adenosylhomocysteine
pdb|2ORE|E Chain E, Binary Structure Of Escherichia Coli Dna Adenine
Methyltransferase And S-adenosylhomocysteine
pdb|2ORE|F Chain F, Binary Structure Of Escherichia Coli Dna Adenine
Methyltransferase And S-adenosylhomocysteine
Length = 298
Score = 27.7 bits (60), Expect = 6.2, Method: Compositional matrix adjust.
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 8/48 (16%)
Query: 190 FSGYIVYDTN-------NLIKRYTYDEYITAAIELYLDIVNIFIAFLQ 230
FS YI+ D N N++K T DEY+ AA EL++ N + Q
Sbjct: 67 FSRYILADINSDLISLYNIVKMRT-DEYVQAARELFVPETNCAEVYYQ 113
>pdb|2G1P|A Chain A, Structure Of E. Coli Dna Adenine Methyltransferase (Dam)
pdb|2G1P|B Chain B, Structure Of E. Coli Dna Adenine Methyltransferase (Dam)
Length = 278
Score = 27.3 bits (59), Expect = 7.2, Method: Compositional matrix adjust.
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 8/48 (16%)
Query: 190 FSGYIVYDTN-------NLIKRYTYDEYITAAIELYLDIVNIFIAFLQ 230
FS YI+ D N N++K T DEY+ AA EL++ N + Q
Sbjct: 47 FSRYILADINSDLISLYNIVKMRT-DEYVQAARELFVPETNCAEVYYQ 93
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.333 0.147 0.450
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,071,544
Number of Sequences: 62578
Number of extensions: 213296
Number of successful extensions: 644
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 642
Number of HSP's gapped (non-prelim): 5
length of query: 236
length of database: 14,973,337
effective HSP length: 96
effective length of query: 140
effective length of database: 8,965,849
effective search space: 1255218860
effective search space used: 1255218860
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 50 (23.9 bits)