BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026639
         (235 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1RK8|C Chain C, Structure Of The Cytosolic Protein Pym Bound To The
          Mago- Y14 Core Of The Exon Junction Complex
          Length = 58

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 5/59 (8%)

Query: 18 LSKTLKEGE-RILAPTRRPDGTLRKPIRIRAGYVPQDEVAIYQSKGALLRKELTALQEA 75
          +S  L+  E + +  T+RPDGT RK  R++ GYVPQ+EV +Y+SKG    K+  A ++A
Sbjct: 1  MSTYLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKG----KQFVAQRQA 55


>pdb|3FKY|A Chain A, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|B Chain B, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|C Chain C, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|D Chain D, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|E Chain E, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|F Chain F, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|G Chain G, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|H Chain H, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|I Chain I, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|J Chain J, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|K Chain K, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|L Chain L, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|M Chain M, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|N Chain N, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|O Chain O, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|P Chain P, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|Q Chain Q, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|R Chain R, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|S Chain S, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
 pdb|3FKY|T Chain T, Crystal Structure Of The Glutamine Synthetase
          Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
          Length = 370

 Score = 28.1 bits (61), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 12/56 (21%)

Query: 44 RIRAGYVPQDEVAIYQSKGALLRKELTALQEAP------------PGYDPELDAKP 87
          RI A YV  D     +SKG  L+K +T++ + P            PG+D ++  KP
Sbjct: 23 RIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDSDIYLKP 78


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.304    0.126    0.337 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,866,037
Number of Sequences: 62578
Number of extensions: 199312
Number of successful extensions: 281
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 280
Number of HSP's gapped (non-prelim): 2
length of query: 235
length of database: 14,973,337
effective HSP length: 96
effective length of query: 139
effective length of database: 8,965,849
effective search space: 1246253011
effective search space used: 1246253011
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 50 (23.9 bits)