Citrus Sinensis ID: 026644


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MLLEASSALSLVSPQKEALNPLFSSVSSAFPPNPSLRFSSPKNDNGVVVCASKNANNSPLTGVIFAPFEEVKKELDLVPTVPQLSLARHKFTDDCEAAINEQINVEYNVSYVYHAMFAYFDRDNVALKGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSILMPLSEFDHAEKGDALYAMELTLSLEKLTNEKLLNLHKVSSLLPRTYYDVKLADGIRALFIKVIVFRNANA
cccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccHHHHHHHHccccccccccccHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcccc
**********************************************VVVCASKNANNSPLTGVIFAPFEEVKKELDLVPTVPQLSLARHKFTDDCEAAINEQINVEYNVSYVYHAMFAYFDRDNVALKGLAKFFKESSEEEREHAEKLMEYQNKRGGKVKLQSILMPLSEFDHAEKGDALYAMELTLSLEKLTNEKLLNLHKVSSLLPRTYYDVKLADGIRALFIKVIVFR****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLEASSALSLVSPQKEALNPLFSSVSSAFPPNPSLRFSSPKNDNGVVVCASKNANNSPLTGVIFAPFEEVKKELDLVPTVPQLSLARHKFTDDCEAAINEQINVEYNVSYVYHAMFAYFDRDNVALKGLAKFxxxxxxxxxxxxxxxxxxxxxxGGKVKLQSILMPLSEFDHAEKGDALYAMELTLSLEKLTNEKLLNLHKVSSLLPRTYYDVKLADGIRALFIKVIVFRNANA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferritin-3, chloroplastic Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.confidentQ948P6
Ferritin-2, chloroplastic Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.probableQ8H1T3
Ferritin-1, chloroplastic Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation.probableP29036

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.16.-.-Oxidizing metal ions.probable
1.16.3.-With oxygen as acceptor.probable
1.16.3.1Ferroxidase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A68, chain A
Confidence level:very confident
Coverage over the Query: 64-233
View the alignment between query and template
View the model in PyMOL