Citrus Sinensis ID: 026646

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MEIASSDNSDWLIDYSIVDDIPIAGNFDWPSQAAPAVNASSAASVTIDCSFGDSDGPKEVEAGSRKRLRSESCCVSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDKATILSDAVQMMEQLRTEAQKLKQSNENLQEKIKELKAEKNELRDEKQRLKADKEKLEQQVKAMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccc
********SDWLIDYSIVDDIPIAGNFDWPSQA*************I******************************************LNERFLELGSML*********KATILSDAVQMMEQLRTE*******************************************************************QVAGNKLVPFIGYPGVAMWQFMPPA**********RPP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIASSDNSDWLIDYSIVDDIPIAGNFDWPSQAAPAVNASSAASVTIDCSFGDSDGPKEVEAGSRKRLRSESCCVSGSKACREKLRRDRLNERFLELGSMLEPGRPPKTDKATIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxMSAPSGFLPHPSSMSAAFAAQSQVAGNKLVPFIGYPGVAMWQFMPPAAVDTSQDHVLRPPVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor ILR3 Transcription factor. Plays a role in resistance to amide-linked indole-3-acetic acid (IAA) conjugates such as IAA-Leu and IAA-Phe. May regulates gene expression in response to metal homeostasis changes.probableQ9FH37

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NKP, chain A
Confidence level:confident
Coverage over the Query: 75-154
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 153-174
View the alignment between query and template
View the model in PyMOL