Query         026649
Match_columns 235
No_of_seqs    267 out of 1763
Neff          6.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:47:39 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026649.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026649hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00368 universal minicircle  100.0 1.9E-28 4.1E-33  198.6  10.2  133   52-225     2-148 (148)
  2 PTZ00368 universal minicircle   99.9 3.1E-27 6.8E-32  191.5   9.4  128   13-152     1-148 (148)
  3 COG5082 AIR1 Arginine methyltr  99.8 3.7E-21   8E-26  159.7   6.5  105   94-230    59-178 (190)
  4 COG5082 AIR1 Arginine methyltr  99.8 6.3E-20 1.4E-24  152.3   6.7   85    5-90     53-141 (190)
  5 KOG4400 E3 ubiquitin ligase in  99.8 5.6E-18 1.2E-22  149.2  12.4  194   11-226    23-242 (261)
  6 KOG4400 E3 ubiquitin ligase in  99.6 1.7E-15 3.7E-20  133.4   9.7  106   95-228    72-186 (261)
  7 PF00098 zf-CCHC:  Zinc knuckle  98.2 5.7E-07 1.2E-11   47.4   1.5   16  208-223     2-17  (18)
  8 PF00098 zf-CCHC:  Zinc knuckle  98.1 2.2E-06 4.7E-11   45.1   1.8   17  188-204     2-18  (18)
  9 PF13696 zf-CCHC_2:  Zinc knuck  96.8   0.001 2.2E-08   40.1   2.1   19  206-224     8-26  (32)
 10 PF13696 zf-CCHC_2:  Zinc knuck  96.4  0.0016 3.4E-08   39.2   1.1   22  131-152     6-27  (32)
 11 PF13917 zf-CCHC_3:  Zinc knuck  96.4   0.002 4.4E-08   41.2   1.6   19  205-223     3-21  (42)
 12 smart00343 ZnF_C2HC zinc finge  94.2   0.026 5.6E-07   32.0   1.3   17  208-224     1-17  (26)
 13 PF14392 zf-CCHC_4:  Zinc knuck  94.2   0.017 3.7E-07   38.0   0.5   25    5-29     24-48  (49)
 14 PF13917 zf-CCHC_3:  Zinc knuck  93.4   0.042   9E-07   35.2   1.2   19  186-204     4-22  (42)
 15 KOG0109 RNA-binding protein LA  93.3   0.043 9.4E-07   49.1   1.6   17  187-203   161-177 (346)
 16 smart00343 ZnF_C2HC zinc finge  92.8   0.052 1.1E-06   30.7   1.0   17  188-204     1-17  (26)
 17 KOG0119 Splicing factor 1/bran  91.8    0.12 2.7E-06   49.2   2.7   37  116-152   263-304 (554)
 18 KOG0119 Splicing factor 1/bran  90.6    0.19 4.2E-06   47.9   2.7   39  187-225   262-304 (554)
 19 KOG0109 RNA-binding protein LA  88.0    0.26 5.6E-06   44.3   1.4   23  206-228   160-182 (346)
 20 PF14787 zf-CCHC_5:  GAG-polypr  86.6    0.48   1E-05   29.2   1.6   18  208-225     4-21  (36)
 21 PF15288 zf-CCHC_6:  Zinc knuck  86.5    0.37   8E-06   30.5   1.1   12   14-25      3-14  (40)
 22 COG5222 Uncharacterized conser  86.2    0.53 1.2E-05   42.4   2.4   22  205-226   175-196 (427)
 23 PF15288 zf-CCHC_6:  Zinc knuck  83.6    0.67 1.5E-05   29.3   1.3   18  207-224     2-21  (40)
 24 KOG0314 Predicted E3 ubiquitin  83.2     1.7 3.8E-05   41.3   4.5   42  187-228   134-180 (448)
 25 PF14392 zf-CCHC_4:  Zinc knuck  81.6    0.59 1.3E-05   30.6   0.5   17  187-203    32-48  (49)
 26 PF14787 zf-CCHC_5:  GAG-polypr  79.3     1.2 2.5E-05   27.5   1.2   17   13-29      3-19  (36)
 27 COG5222 Uncharacterized conser  71.1     1.8 3.9E-05   39.1   0.8   21  134-154   177-197 (427)
 28 KOG0107 Alternative splicing f  64.0      16 0.00034   30.8   5.0   34  189-228   103-136 (195)
 29 KOG2044 5'-3' exonuclease HKE1  62.2       3 6.5E-05   42.3   0.5   21    9-29    257-277 (931)
 30 PF01485 IBR:  IBR domain;  Int  53.4      12 0.00026   24.8   2.2   13   51-63     49-61  (64)
 31 KOG0314 Predicted E3 ubiquitin  52.7      20 0.00044   34.2   4.3   18  187-204   159-176 (448)
 32 KOG2673 Uncharacterized conser  46.4     7.7 0.00017   37.0   0.4   26  208-233   130-155 (485)
 33 KOG0107 Alternative splicing f  45.5      19 0.00041   30.3   2.5   19  206-224   100-118 (195)
 34 KOG3116 Predicted C3H1-type Zn  30.2      14  0.0003   30.1  -0.5   19  186-204    27-45  (177)
 35 PF12353 eIF3g:  Eukaryotic tra  24.4      46   0.001   26.2   1.5   19  185-204   105-123 (128)
 36 PF12353 eIF3g:  Eukaryotic tra  20.9      60  0.0013   25.6   1.5   22  205-227   105-126 (128)

No 1  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=99.95  E-value=1.9e-28  Score=198.63  Aligned_cols=133  Identities=34%  Similarity=0.819  Sum_probs=89.1

Q ss_pred             cCCCCCCCCCCCCCCCC--------ccccccCCCCCcCCccCCCCcccCCCCcccccCCCCCCCCCCCCCcccccccccC
Q 026649           52 RCWNCREPGHMASNCHN--------EGICHSCGKTGHRARDCSTHVQSGGDLRLCNNCYKPGHIAADCTNDKACKNCRKT  123 (235)
Q Consensus        52 ~C~~Cg~~GH~~~~Cp~--------~~~C~~Cg~~GH~~~~Cp~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~  123 (235)
                      +||+|++.||++++||+        ...||+|++.||++++||..... .....|++|++.||++++||+...      .
T Consensus         2 ~C~~C~~~GH~~~~c~~~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~~~-~~~~~C~~Cg~~GH~~~~Cp~~~~------~   74 (148)
T PTZ00368          2 VCYRCGGVGHQSRECPNSAPAGAAKARPCYKCGEPGHLSRECPSAPGG-RGERSCYNCGKTGHLSRECPEAPP------G   74 (148)
T ss_pred             cCCCCCCCCcCcccCcCCCCCCCCCCccCccCCCCCcCcccCcCCCCC-CCCcccCCCCCcCcCcccCCCccc------C
Confidence            45555555555555554        23577777777777777654321 123445555555555555554210      0


Q ss_pred             ccccCCCCCCCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCccccccCCCCccCCCCC
Q 026649          124 GHIARDCQNEPVCNLCNIAGHVARQCPKGDSLGERGGGGGGERGGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCV  203 (235)
Q Consensus       124 GH~~~~Cp~~~~C~~C~~~GH~~~~Cp~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~rdC~  203 (235)
                             .....|++|++.||++++||+....     .                      ....+||+|++.||+++|||
T Consensus        75 -------~~~~~C~~Cg~~GH~~~~C~~~~~~-----~----------------------~~~~~C~~Cg~~gH~~~~C~  120 (148)
T PTZ00368         75 -------SGPRSCYNCGQTGHISRECPNRAKG-----G----------------------AARRACYNCGGEGHISRDCP  120 (148)
T ss_pred             -------CCCcccCcCCCCCcccccCCCcccc-----c----------------------ccchhhcccCcCCcchhcCC
Confidence                   0234799999999999999985421     0                      12368999999999999999


Q ss_pred             CC------CcceecCCCCCcCCCCCCCC
Q 026649          204 GP------LIICRNCGGRGHMAYECPSG  225 (235)
Q Consensus       204 ~~------~~~C~~Cg~~GH~~~~Cp~~  225 (235)
                      ..      .+.||+|++.|||++|||+.
T Consensus       121 ~~~~~~~~~~~C~~Cg~~gH~~~dCp~~  148 (148)
T PTZ00368        121 NAGKRPGGDKTCYNCGQTGHLSRDCPDK  148 (148)
T ss_pred             CccccCCCCCccccCCCcCcccccCCCC
Confidence            84      58999999999999999973


No 2  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=99.94  E-value=3.1e-27  Score=191.48  Aligned_cols=128  Identities=42%  Similarity=0.965  Sum_probs=82.1

Q ss_pred             ccccccCCCCccCCCCCCCcccCCCCCCCCCCccccccccCCCCCCCCCCCCCCCCc------cccccCCCCCcCCccCC
Q 026649           13 NLCNNCKRPGHFARECPNVAVCNNCGLPGHIASECTTQARCWNCREPGHMASNCHNE------GICHSCGKTGHRARDCS   86 (235)
Q Consensus        13 ~~C~~C~~~GH~~~~Cp~~~~C~~Cg~~GH~~~~C~~~~~C~~Cg~~GH~~~~Cp~~------~~C~~Cg~~GH~~~~Cp   86 (235)
                      ++||+|++.||++++||...      ..+..     ....||+|++.||++++||+.      ..|++|++.||++++||
T Consensus         1 ~~C~~C~~~GH~~~~c~~~~------~~~~~-----~~~~C~~Cg~~GH~~~~Cp~~~~~~~~~~C~~Cg~~GH~~~~Cp   69 (148)
T PTZ00368          1 MVCYRCGGVGHQSRECPNSA------PAGAA-----KARPCYKCGEPGHLSRECPSAPGGRGERSCYNCGKTGHLSRECP   69 (148)
T ss_pred             CcCCCCCCCCcCcccCcCCC------CCCCC-----CCccCccCCCCCcCcccCcCCCCCCCCcccCCCCCcCcCcccCC
Confidence            47999999999999998731      00000     013444444444444444442      24666666666666666


Q ss_pred             CCcccCCCCcccccCCCCCCCCCCCCCcc-------cccccccCccccCCCCCC-------CCCCccccCCCCCCCCCCC
Q 026649           87 THVQSGGDLRLCNNCYKPGHIAADCTNDK-------ACKNCRKTGHIARDCQNE-------PVCNLCNIAGHVARQCPKG  152 (235)
Q Consensus        87 ~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~-------~C~~Cg~~GH~~~~Cp~~-------~~C~~C~~~GH~~~~Cp~~  152 (235)
                      +.... ...+.|++|++.||++++||+..       .||+|++.||++++||+.       ++||+|++.|||++|||++
T Consensus        70 ~~~~~-~~~~~C~~Cg~~GH~~~~C~~~~~~~~~~~~C~~Cg~~gH~~~~C~~~~~~~~~~~~C~~Cg~~gH~~~dCp~~  148 (148)
T PTZ00368         70 EAPPG-SGPRSCYNCGQTGHISRECPNRAKGGAARRACYNCGGEGHISRDCPNAGKRPGGDKTCYNCGQTGHLSRDCPDK  148 (148)
T ss_pred             CcccC-CCCcccCcCCCCCcccccCCCcccccccchhhcccCcCCcchhcCCCccccCCCCCccccCCCcCcccccCCCC
Confidence            54322 13456777777777777776532       577777777777777763       5899999999999999873


No 3  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=99.83  E-value=3.7e-21  Score=159.66  Aligned_cols=105  Identities=33%  Similarity=0.781  Sum_probs=83.8

Q ss_pred             CCcccccCCCCCCCCCCCCCcccccccccCccccCCCCCCCCCCccccCCCCCCCC-CCCCCCCCCCCCCCCCCCCCCCC
Q 026649           94 DLRLCNNCYKPGHIAADCTNDKACKNCRKTGHIARDCQNEPVCNLCNIAGHVARQC-PKGDSLGERGGGGGGERGGGGGG  172 (235)
Q Consensus        94 ~~~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~~~~C~~C~~~GH~~~~C-p~~~~~~~~~~~~~~~~~~~~g~  172 (235)
                      +.+.|++|++.||+++||| .++||+|...+|.+..||+..+|++|++.||++++| |..+                   
T Consensus        59 ~~~~C~nCg~~GH~~~DCP-~~iC~~C~~~~H~s~~C~~~~~C~~Cg~~GH~~~dC~P~~~-------------------  118 (190)
T COG5082          59 ENPVCFNCGQNGHLRRDCP-HSICYNCSWDGHRSNHCPKPKKCYNCGETGHLSRDCNPSKD-------------------  118 (190)
T ss_pred             cccccchhcccCcccccCC-hhHhhhcCCCCcccccCCcccccccccccCccccccCcccc-------------------
Confidence            4567888888888888888 478888866888888888888888888888888888 4543                   


Q ss_pred             CCCCCCCCCCCccCccccccCCCCccCCCCCC--------------CCcceecCCCCCcCCCCCCCCCCCCC
Q 026649          173 DGGGGGGRYVGYHDVICRSCNQMGHMSRDCVG--------------PLIICRNCGGRGHMAYECPSGRIADR  230 (235)
Q Consensus       173 ~~~~~~~~~~~~~~~~C~~C~~~gH~~rdC~~--------------~~~~C~~Cg~~GH~~~~Cp~~~~~~~  230 (235)
                                  +.+.|+.|+...|.+++||.              ..+.||+|+..+||++||+.++.+..
T Consensus       119 ------------~~~~C~~C~s~~H~s~~Cp~~~k~y~~~~~~~~~~~~~cy~c~~~~H~~~dc~~~~~s~~  178 (190)
T COG5082         119 ------------QQKSCFDCNSTRHSSEDCPSIWKHYVLNNGDGHPIKKFCYSCGSAGHFGDDCKEPRSSRV  178 (190)
T ss_pred             ------------cCcceeccCCCccccccCcccccccccccCCCcceeeeccccCCccccCCCCCCCccccc
Confidence                        34678888888888888886              25789999999999999987665543


No 4  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=99.80  E-value=6.3e-20  Score=152.33  Aligned_cols=85  Identities=33%  Similarity=0.905  Sum_probs=70.3

Q ss_pred             ccccCcCCccccccCCCCccCCCCCCCcccCCCCCCCCCCccccccccCCCCCCCCCCCCCC-CCc---cccccCCCCCc
Q 026649            5 VLSFMSQGNLCNNCKRPGHFARECPNVAVCNNCGLPGHIASECTTQARCWNCREPGHMASNC-HNE---GICHSCGKTGH   80 (235)
Q Consensus         5 ~~~~~~~~~~C~~C~~~GH~~~~Cp~~~~C~~Cg~~GH~~~~C~~~~~C~~Cg~~GH~~~~C-p~~---~~C~~Cg~~GH   80 (235)
                      +..+.....+|+||++.||++++|| ..+|++|...||.+..||..++|++|++.||++++| |..   ..|+.|....|
T Consensus        53 ~~~~~~~~~~C~nCg~~GH~~~DCP-~~iC~~C~~~~H~s~~C~~~~~C~~Cg~~GH~~~dC~P~~~~~~~C~~C~s~~H  131 (190)
T COG5082          53 VSAIREENPVCFNCGQNGHLRRDCP-HSICYNCSWDGHRSNHCPKPKKCYNCGETGHLSRDCNPSKDQQKSCFDCNSTRH  131 (190)
T ss_pred             cccccccccccchhcccCcccccCC-hhHhhhcCCCCcccccCCcccccccccccCccccccCcccccCcceeccCCCcc
Confidence            3344455779999999999999999 569999977899999999888899999999999999 543   36888888888


Q ss_pred             CCccCCCCcc
Q 026649           81 RARDCSTHVQ   90 (235)
Q Consensus        81 ~~~~Cp~~~~   90 (235)
                      ++++||++|+
T Consensus       132 ~s~~Cp~~~k  141 (190)
T COG5082         132 SSEDCPSIWK  141 (190)
T ss_pred             ccccCccccc
Confidence            8888888886


No 5  
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.76  E-value=5.6e-18  Score=149.20  Aligned_cols=194  Identities=29%  Similarity=0.617  Sum_probs=149.8

Q ss_pred             CCccccccCCCCccCCCCCCCc-----------ccCCCCCCCCCCccccccccCCCCCCCCCCCCCCCC-ccccccCCCC
Q 026649           11 QGNLCNNCKRPGHFARECPNVA-----------VCNNCGLPGHIASECTTQARCWNCREPGHMASNCHN-EGICHSCGKT   78 (235)
Q Consensus        11 ~~~~C~~C~~~GH~~~~Cp~~~-----------~C~~Cg~~GH~~~~C~~~~~C~~Cg~~GH~~~~Cp~-~~~C~~Cg~~   78 (235)
                      ....++++.+.+|.+..++...           .+..+...+|+...++. ..|+.|++.+|..++|+. ...|++|++.
T Consensus        23 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~c~~~g~~~~~~~~~~~~~~~c~~C~~~  101 (261)
T KOG4400|consen   23 SSPNELKCLKSGHKAVSCTDGDSRGDSSKSDGPGCVSTSPNGPLKSECPE-VSCYICGEKGHLGRRCTRIAAACFNCGEG  101 (261)
T ss_pred             cchhhhhhccccCcceecccCCcccccccCCCCcccccccCcccCCCCCC-ceeeecCCCCchhhcCcccchhhhhCCCC
Confidence            4568999999999999998652           34445566677666766 699999999999999996 6789999999


Q ss_pred             CcCCccCCCCcccCCCCcccccCCCCCCCC-CCCC-----CcccccccccCccccCCCCC--CCCCCccccCCCCCCCCC
Q 026649           79 GHRARDCSTHVQSGGDLRLCNNCYKPGHIA-ADCT-----NDKACKNCRKTGHIARDCQN--EPVCNLCNIAGHVARQCP  150 (235)
Q Consensus        79 GH~~~~Cp~~~~~~~~~~~C~~Cg~~GH~~-~~Cp-----~~~~C~~Cg~~GH~~~~Cp~--~~~C~~C~~~GH~~~~Cp  150 (235)
                      ||++++||.++........||.|++.+|.. .++.     ..+.||+|++.||++.+||+  ..+||.|+..+|++++||
T Consensus       102 gH~~~~c~~~~~~~~~~~~~~~c~~~gh~~~~~~~~~~~~~~~~Cy~Cg~~GH~s~~C~~~~~~~c~~c~~~~h~~~~C~  181 (261)
T KOG4400|consen  102 GHIERDCPEAGKEGSSETSCYSCGKTGHRGCPDADPVDGPKPAKCYSCGEQGHISDDCPENKGGTCFRCGKVGHGSRDCP  181 (261)
T ss_pred             ccchhhCCcccCcccccceeeccCCCccccCcccccccCCCCCccCCCCcCCcchhhCCCCCCCccccCCCcceecccCC
Confidence            999999999987443466899999999999 4332     22459999999999999994  789999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCccCccccccCCCCccCCCCCC------CCcceecCCCCCcCCCCCCC
Q 026649          151 KGDSLGERGGGGGGERGGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCVG------PLIICRNCGGRGHMAYECPS  224 (235)
Q Consensus       151 ~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~rdC~~------~~~~C~~Cg~~GH~~~~Cp~  224 (235)
                      .+.........              ..      ...-.++ +...+|+.++++.      ....+|++...+|.+.+|-+
T Consensus       182 ~~~~~~~~~~~--------------~~------~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (261)
T KOG4400|consen  182 SKQKSKSKQGG--------------QR------KGFGACY-DYPQGHKQRACGGSGPDDNFNDSCYNKLSSGKLDQDCKQ  240 (261)
T ss_pred             ccccccccCcc--------------cc------cccccCc-cccccccccccCCCCcccccccccccccccccccchhhh
Confidence            98754211110              00      0112233 6678999999876      46788888888888877765


Q ss_pred             CC
Q 026649          225 GR  226 (235)
Q Consensus       225 ~~  226 (235)
                      ..
T Consensus       241 ~~  242 (261)
T KOG4400|consen  241 SS  242 (261)
T ss_pred             hc
Confidence            43


No 6  
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.62  E-value=1.7e-15  Score=133.44  Aligned_cols=106  Identities=37%  Similarity=0.773  Sum_probs=63.0

Q ss_pred             CcccccCCCCCCCCCCCCC-cccccccccCccccCCCCCC-------CCCCccccCCCCCCCCCCCCCCCCCCCCCCCCC
Q 026649           95 LRLCNNCYKPGHIAADCTN-DKACKNCRKTGHIARDCQNE-------PVCNLCNIAGHVARQCPKGDSLGERGGGGGGER  166 (235)
Q Consensus        95 ~~~C~~Cg~~GH~~~~Cp~-~~~C~~Cg~~GH~~~~Cp~~-------~~C~~C~~~GH~~~~Cp~~~~~~~~~~~~~~~~  166 (235)
                      ...|++|++.+|++.+|+. ...|++|++.||++++||..       ..||.|+..||..  |+......          
T Consensus        72 ~~~c~~~g~~~~~~~~~~~~~~~c~~C~~~gH~~~~c~~~~~~~~~~~~~~~c~~~gh~~--~~~~~~~~----------  139 (261)
T KOG4400|consen   72 EVSCYICGEKGHLGRRCTRIAAACFNCGEGGHIERDCPEAGKEGSSETSCYSCGKTGHRG--CPDADPVD----------  139 (261)
T ss_pred             CceeeecCCCCchhhcCcccchhhhhCCCCccchhhCCcccCcccccceeeccCCCcccc--Cccccccc----------
Confidence            3456666666666666653 34566666666666666532       2466777777776  33222100          


Q ss_pred             CCCCCCCCCCCCCCCCCccCccccccCCCCccCCCCCCC-CcceecCCCCCcCCCCCCCCCCC
Q 026649          167 GGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCVGP-LIICRNCGGRGHMAYECPSGRIA  228 (235)
Q Consensus       167 ~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~rdC~~~-~~~C~~Cg~~GH~~~~Cp~~~~~  228 (235)
                                     ..+. +.||+|+++|||++|||.+ ...||.|++.+|++++||+....
T Consensus       140 ---------------~~~~-~~Cy~Cg~~GH~s~~C~~~~~~~c~~c~~~~h~~~~C~~~~~~  186 (261)
T KOG4400|consen  140 ---------------GPKP-AKCYSCGEQGHISDDCPENKGGTCFRCGKVGHGSRDCPSKQKS  186 (261)
T ss_pred             ---------------CCCC-CccCCCCcCCcchhhCCCCCCCccccCCCcceecccCCccccc
Confidence                           0022 6677777777777777765 67777777777777777765443


No 7  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=98.23  E-value=5.7e-07  Score=47.40  Aligned_cols=16  Identities=56%  Similarity=1.329  Sum_probs=8.9

Q ss_pred             ceecCCCCCcCCCCCC
Q 026649          208 ICRNCGGRGHMAYECP  223 (235)
Q Consensus       208 ~C~~Cg~~GH~~~~Cp  223 (235)
                      .||+|++.||+++|||
T Consensus         2 ~C~~C~~~GH~~~~Cp   17 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCP   17 (18)
T ss_dssp             BCTTTSCSSSCGCTSS
T ss_pred             cCcCCCCcCcccccCc
Confidence            4555555555555555


No 8  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=98.07  E-value=2.2e-06  Score=45.15  Aligned_cols=17  Identities=41%  Similarity=1.028  Sum_probs=15.9

Q ss_pred             cccccCCCCccCCCCCC
Q 026649          188 ICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       188 ~C~~C~~~gH~~rdC~~  204 (235)
                      +||+|+++||+++|||+
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            69999999999999984


No 9  
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=96.79  E-value=0.001  Score=40.05  Aligned_cols=19  Identities=37%  Similarity=1.097  Sum_probs=10.6

Q ss_pred             CcceecCCCCCcCCCCCCC
Q 026649          206 LIICRNCGGRGHMAYECPS  224 (235)
Q Consensus       206 ~~~C~~Cg~~GH~~~~Cp~  224 (235)
                      .-+|+.|++.|||..|||+
T Consensus         8 ~Y~C~~C~~~GH~i~dCP~   26 (32)
T PF13696_consen    8 GYVCHRCGQKGHWIQDCPT   26 (32)
T ss_pred             CCEeecCCCCCccHhHCCC
Confidence            3455555555555555555


No 10 
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=96.36  E-value=0.0016  Score=39.20  Aligned_cols=22  Identities=32%  Similarity=0.753  Sum_probs=16.4

Q ss_pred             CCCCCCCccccCCCCCCCCCCC
Q 026649          131 QNEPVCNLCNIAGHVARQCPKG  152 (235)
Q Consensus       131 p~~~~C~~C~~~GH~~~~Cp~~  152 (235)
                      |..-+|++|+++||+.++||++
T Consensus         6 P~~Y~C~~C~~~GH~i~dCP~~   27 (32)
T PF13696_consen    6 PPGYVCHRCGQKGHWIQDCPTN   27 (32)
T ss_pred             CCCCEeecCCCCCccHhHCCCC
Confidence            3445788888888888888874


No 11 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=96.35  E-value=0.002  Score=41.25  Aligned_cols=19  Identities=47%  Similarity=1.316  Sum_probs=15.0

Q ss_pred             CCcceecCCCCCcCCCCCC
Q 026649          205 PLIICRNCGGRGHMAYECP  223 (235)
Q Consensus       205 ~~~~C~~Cg~~GH~~~~Cp  223 (235)
                      ..+.|.+|++.|||..|||
T Consensus         3 ~~~~CqkC~~~GH~tyeC~   21 (42)
T PF13917_consen    3 ARVRCQKCGQKGHWTYECP   21 (42)
T ss_pred             CCCcCcccCCCCcchhhCC
Confidence            3567888888888888888


No 12 
>smart00343 ZnF_C2HC zinc finger.
Probab=94.22  E-value=0.026  Score=31.98  Aligned_cols=17  Identities=53%  Similarity=1.300  Sum_probs=11.6

Q ss_pred             ceecCCCCCcCCCCCCC
Q 026649          208 ICRNCGGRGHMAYECPS  224 (235)
Q Consensus       208 ~C~~Cg~~GH~~~~Cp~  224 (235)
                      .|++|++.||++++||+
T Consensus         1 ~C~~CG~~GH~~~~C~~   17 (26)
T smart00343        1 KCYNCGKEGHIARDCPK   17 (26)
T ss_pred             CCccCCCCCcchhhCCc
Confidence            36677777777777763


No 13 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=94.15  E-value=0.017  Score=37.97  Aligned_cols=25  Identities=32%  Similarity=0.789  Sum_probs=21.2

Q ss_pred             ccccCcCCccccccCCCCccCCCCC
Q 026649            5 VLSFMSQGNLCNNCKRPGHFARECP   29 (235)
Q Consensus         5 ~~~~~~~~~~C~~C~~~GH~~~~Cp   29 (235)
                      .+.|...+.+|++|+..||..++||
T Consensus        24 ~v~YE~lp~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   24 KVKYERLPRFCFHCGRIGHSDKECP   48 (49)
T ss_pred             EEEECCcChhhcCCCCcCcCHhHcC
Confidence            3567778899999999999999997


No 14 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=93.40  E-value=0.042  Score=35.19  Aligned_cols=19  Identities=37%  Similarity=0.896  Sum_probs=17.3

Q ss_pred             CccccccCCCCccCCCCCC
Q 026649          186 DVICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       186 ~~~C~~C~~~gH~~rdC~~  204 (235)
                      ...|.+|++.|||..+|++
T Consensus         4 ~~~CqkC~~~GH~tyeC~~   22 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECPN   22 (42)
T ss_pred             CCcCcccCCCCcchhhCCC
Confidence            4789999999999999993


No 15 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=93.28  E-value=0.043  Score=49.10  Aligned_cols=17  Identities=35%  Similarity=0.868  Sum_probs=9.6

Q ss_pred             ccccccCCCCccCCCCC
Q 026649          187 VICRSCNQMGHMSRDCV  203 (235)
Q Consensus       187 ~~C~~C~~~gH~~rdC~  203 (235)
                      ..||+|+++|||+++||
T Consensus       161 ~~cyrcGkeghwskEcP  177 (346)
T KOG0109|consen  161 SGCYRCGKEGHWSKECP  177 (346)
T ss_pred             HHheeccccccccccCC
Confidence            44555555555555555


No 16 
>smart00343 ZnF_C2HC zinc finger.
Probab=92.82  E-value=0.052  Score=30.73  Aligned_cols=17  Identities=41%  Similarity=1.060  Sum_probs=15.4

Q ss_pred             cccccCCCCccCCCCCC
Q 026649          188 ICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       188 ~C~~C~~~gH~~rdC~~  204 (235)
                      +|++|++.||++++||.
T Consensus         1 ~C~~CG~~GH~~~~C~~   17 (26)
T smart00343        1 KCYNCGKEGHIARDCPK   17 (26)
T ss_pred             CCccCCCCCcchhhCCc
Confidence            48999999999999983


No 17 
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]
Probab=91.84  E-value=0.12  Score=49.19  Aligned_cols=37  Identities=41%  Similarity=0.985  Sum_probs=20.7

Q ss_pred             cccccccCccccCCCCCC-----CCCCccccCCCCCCCCCCC
Q 026649          116 ACKNCRKTGHIARDCQNE-----PVCNLCNIAGHVARQCPKG  152 (235)
Q Consensus       116 ~C~~Cg~~GH~~~~Cp~~-----~~C~~C~~~GH~~~~Cp~~  152 (235)
                      .|.+|+..+|-..+||..     .+|.+|+..||+++||+.+
T Consensus       263 ~c~~cg~~~H~q~~cp~r~~~~~n~c~~cg~~gH~~~dc~~~  304 (554)
T KOG0119|consen  263 ACRNCGSTGHKQYDCPGRIPNTTNVCKICGPLGHISIDCKVN  304 (554)
T ss_pred             cccccCCCccccccCCcccccccccccccCCcccccccCCCc
Confidence            344444444444444432     2677777777777777665


No 18 
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]
Probab=90.62  E-value=0.19  Score=47.91  Aligned_cols=39  Identities=36%  Similarity=0.928  Sum_probs=35.3

Q ss_pred             ccccccCCCCccCCCCCCC----CcceecCCCCCcCCCCCCCC
Q 026649          187 VICRSCNQMGHMSRDCVGP----LIICRNCGGRGHMAYECPSG  225 (235)
Q Consensus       187 ~~C~~C~~~gH~~rdC~~~----~~~C~~Cg~~GH~~~~Cp~~  225 (235)
                      ..|.+|+..||-.-|||..    ..+|..|+..|||+.||+..
T Consensus       262 ~~c~~cg~~~H~q~~cp~r~~~~~n~c~~cg~~gH~~~dc~~~  304 (554)
T KOG0119|consen  262 RACRNCGSTGHKQYDCPGRIPNTTNVCKICGPLGHISIDCKVN  304 (554)
T ss_pred             ccccccCCCccccccCCcccccccccccccCCcccccccCCCc
Confidence            6799999999999999972    34999999999999999976


No 19 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=88.04  E-value=0.26  Score=44.27  Aligned_cols=23  Identities=39%  Similarity=0.819  Sum_probs=19.7

Q ss_pred             CcceecCCCCCcCCCCCCCCCCC
Q 026649          206 LIICRNCGGRGHMAYECPSGRIA  228 (235)
Q Consensus       206 ~~~C~~Cg~~GH~~~~Cp~~~~~  228 (235)
                      .-.||+||++|||++|||..+..
T Consensus       160 q~~cyrcGkeghwskEcP~~~~~  182 (346)
T KOG0109|consen  160 QSGCYRCGKEGHWSKECPVDRTG  182 (346)
T ss_pred             HHHheeccccccccccCCccCCC
Confidence            46899999999999999986543


No 20 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=86.64  E-value=0.48  Score=29.19  Aligned_cols=18  Identities=44%  Similarity=0.839  Sum_probs=7.0

Q ss_pred             ceecCCCCCcCCCCCCCC
Q 026649          208 ICRNCGGRGHMAYECPSG  225 (235)
Q Consensus       208 ~C~~Cg~~GH~~~~Cp~~  225 (235)
                      .|.+|++-.|||.||-+.
T Consensus         4 ~CprC~kg~Hwa~~C~sk   21 (36)
T PF14787_consen    4 LCPRCGKGFHWASECRSK   21 (36)
T ss_dssp             C-TTTSSSCS-TTT---T
T ss_pred             cCcccCCCcchhhhhhhh
Confidence            455555555555555443


No 21 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=86.52  E-value=0.37  Score=30.47  Aligned_cols=12  Identities=42%  Similarity=0.933  Sum_probs=6.9

Q ss_pred             cccccCCCCccC
Q 026649           14 LCNNCKRPGHFA   25 (235)
Q Consensus        14 ~C~~C~~~GH~~   25 (235)
                      .|.+|+.+||++
T Consensus         3 kC~~CG~~GH~~   14 (40)
T PF15288_consen    3 KCKNCGAFGHMR   14 (40)
T ss_pred             cccccccccccc
Confidence            455566666655


No 22 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=86.17  E-value=0.53  Score=42.44  Aligned_cols=22  Identities=36%  Similarity=1.028  Sum_probs=17.0

Q ss_pred             CCcceecCCCCCcCCCCCCCCC
Q 026649          205 PLIICRNCGGRGHMAYECPSGR  226 (235)
Q Consensus       205 ~~~~C~~Cg~~GH~~~~Cp~~~  226 (235)
                      ++-.||+||++|||...||...
T Consensus       175 pgY~CyRCGqkgHwIqnCpTN~  196 (427)
T COG5222         175 PGYVCYRCGQKGHWIQNCPTNQ  196 (427)
T ss_pred             CceeEEecCCCCchhhcCCCCC
Confidence            4677888888888888888643


No 23 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=83.60  E-value=0.67  Score=29.30  Aligned_cols=18  Identities=50%  Similarity=1.233  Sum_probs=9.6

Q ss_pred             cceecCCCCCcCC--CCCCC
Q 026649          207 IICRNCGGRGHMA--YECPS  224 (235)
Q Consensus       207 ~~C~~Cg~~GH~~--~~Cp~  224 (235)
                      +.|.+||..||+.  +.||.
T Consensus         2 ~kC~~CG~~GH~~t~k~CP~   21 (40)
T PF15288_consen    2 VKCKNCGAFGHMRTNKRCPM   21 (40)
T ss_pred             ccccccccccccccCccCCC
Confidence            3455555555554  45554


No 24 
>KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=83.25  E-value=1.7  Score=41.28  Aligned_cols=42  Identities=29%  Similarity=0.690  Sum_probs=25.6

Q ss_pred             ccccccCCCCccCCCCCC-----CCcceecCCCCCcCCCCCCCCCCC
Q 026649          187 VICRSCNQMGHMSRDCVG-----PLIICRNCGGRGHMAYECPSGRIA  228 (235)
Q Consensus       187 ~~C~~C~~~gH~~rdC~~-----~~~~C~~Cg~~GH~~~~Cp~~~~~  228 (235)
                      .++-.|..++||-.-+..     +...||+|...|||...||.+...
T Consensus       134 ~~~~~~~~~~~~iq~~~~~g~Pppsy~c~rc~~~g~wikacptv~~~  180 (448)
T KOG0314|consen  134 YVCHRCNSPGHFIQHCSTNGSPPPSYKCVKCPTPGPWIKACPTVSGS  180 (448)
T ss_pred             ceeeecccCccccccccccCCCCCCcceecCCCCCccceeccccCCc
Confidence            345555555555544432     567777777777777777765443


No 25 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=81.63  E-value=0.59  Score=30.58  Aligned_cols=17  Identities=29%  Similarity=0.976  Sum_probs=10.1

Q ss_pred             ccccccCCCCccCCCCC
Q 026649          187 VICRSCNQMGHMSRDCV  203 (235)
Q Consensus       187 ~~C~~C~~~gH~~rdC~  203 (235)
                      ..|++|+..||..++||
T Consensus        32 ~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   32 RFCFHCGRIGHSDKECP   48 (49)
T ss_pred             hhhcCCCCcCcCHhHcC
Confidence            44666666666666664


No 26 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=79.25  E-value=1.2  Score=27.50  Aligned_cols=17  Identities=41%  Similarity=0.933  Sum_probs=7.7

Q ss_pred             ccccccCCCCccCCCCC
Q 026649           13 NLCNNCKRPGHFARECP   29 (235)
Q Consensus        13 ~~C~~C~~~GH~~~~Cp   29 (235)
                      ..|++|++--|++++|-
T Consensus         3 ~~CprC~kg~Hwa~~C~   19 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECR   19 (36)
T ss_dssp             -C-TTTSSSCS-TTT--
T ss_pred             ccCcccCCCcchhhhhh
Confidence            45666666666666664


No 27 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=71.07  E-value=1.8  Score=39.14  Aligned_cols=21  Identities=33%  Similarity=0.797  Sum_probs=16.4

Q ss_pred             CCCCccccCCCCCCCCCCCCC
Q 026649          134 PVCNLCNIAGHVARQCPKGDS  154 (235)
Q Consensus       134 ~~C~~C~~~GH~~~~Cp~~~~  154 (235)
                      -+||+||++||+..+||.+..
T Consensus       177 Y~CyRCGqkgHwIqnCpTN~D  197 (427)
T COG5222         177 YVCYRCGQKGHWIQNCPTNQD  197 (427)
T ss_pred             eeEEecCCCCchhhcCCCCCC
Confidence            468888888888888887653


No 28 
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]
Probab=63.98  E-value=16  Score=30.75  Aligned_cols=34  Identities=24%  Similarity=0.490  Sum_probs=24.6

Q ss_pred             ccccCCCCccCCCCCCCCcceecCCCCCcCCCCCCCCCCC
Q 026649          189 CRSCNQMGHMSRDCVGPLIICRNCGGRGHMAYECPSGRIA  228 (235)
Q Consensus       189 C~~C~~~gH~~rdC~~~~~~C~~Cg~~GH~~~~Cp~~~~~  228 (235)
                      ||.|++.||+.+.|.+    +|.+  .++..+.+-++...
T Consensus       103 ~~r~G~rg~~~r~~~~----sy~r--~~r~~~rrrs~~rs  136 (195)
T KOG0107|consen  103 CYRCGERGHIGRNCKD----SYSR--RSRSPRRRRSPSRS  136 (195)
T ss_pred             cccCCCcccccccccc----cccc--cCCCcccccCCCCC
Confidence            9999999999998853    5544  46666666655544


No 29 
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification]
Probab=62.19  E-value=3  Score=42.26  Aligned_cols=21  Identities=29%  Similarity=0.657  Sum_probs=12.0

Q ss_pred             CcCCccccccCCCCccCCCCC
Q 026649            9 MSQGNLCNNCKRPGHFARECP   29 (235)
Q Consensus         9 ~~~~~~C~~C~~~GH~~~~Cp   29 (235)
                      ++++..|+.|+++||.+.+|.
T Consensus       257 P~~~~~C~~cgq~gh~~~dc~  277 (931)
T KOG2044|consen  257 PNKPRRCFLCGQTGHEAKDCE  277 (931)
T ss_pred             CCCcccchhhcccCCcHhhcC
Confidence            555555555555555555554


No 30 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=53.39  E-value=12  Score=24.76  Aligned_cols=13  Identities=38%  Similarity=0.894  Sum_probs=8.5

Q ss_pred             ccCCCCCCCCCCC
Q 026649           51 ARCWNCREPGHMA   63 (235)
Q Consensus        51 ~~C~~Cg~~GH~~   63 (235)
                      .+|+.|+++-|..
T Consensus        49 ~fC~~C~~~~H~~   61 (64)
T PF01485_consen   49 EFCFKCGEPWHEG   61 (64)
T ss_dssp             EECSSSTSESCTT
T ss_pred             cCccccCcccCCC
Confidence            5677777766653


No 31 
>KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.69  E-value=20  Score=34.21  Aligned_cols=18  Identities=22%  Similarity=0.525  Sum_probs=11.5

Q ss_pred             ccccccCCCCccCCCCCC
Q 026649          187 VICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       187 ~~C~~C~~~gH~~rdC~~  204 (235)
                      .+|++|.+.|||...||.
T Consensus       159 y~c~rc~~~g~wikacpt  176 (448)
T KOG0314|consen  159 YKCVKCPTPGPWIKACPT  176 (448)
T ss_pred             cceecCCCCCccceeccc
Confidence            556666666666666664


No 32 
>KOG2673 consensus Uncharacterized conserved protein, contains PSP domain [Function unknown]
Probab=46.37  E-value=7.7  Score=37.00  Aligned_cols=26  Identities=38%  Similarity=0.621  Sum_probs=22.1

Q ss_pred             ceecCCCCCcCCCCCCCCCCCCCCCC
Q 026649          208 ICRNCGGRGHMAYECPSGRIADRGYR  233 (235)
Q Consensus       208 ~C~~Cg~~GH~~~~Cp~~~~~~~~~~  233 (235)
                      .|+||+..-|-.+|||.+..+.||.|
T Consensus       130 ~CFNC~g~~hsLrdC~rp~d~s~I~r  155 (485)
T KOG2673|consen  130 PCFNCGGTPHSLRDCPRPFDFSRIQR  155 (485)
T ss_pred             cccccCCCCCccccCCCccccHHHHH
Confidence            38999999999999999988887754


No 33 
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]
Probab=45.50  E-value=19  Score=30.32  Aligned_cols=19  Identities=37%  Similarity=0.919  Sum_probs=16.9

Q ss_pred             CcceecCCCCCcCCCCCCC
Q 026649          206 LIICRNCGGRGHMAYECPS  224 (235)
Q Consensus       206 ~~~C~~Cg~~GH~~~~Cp~  224 (235)
                      ...||+||+.|||.+.|.+
T Consensus       100 ~~~~~r~G~rg~~~r~~~~  118 (195)
T KOG0107|consen  100 RGFCYRCGERGHIGRNCKD  118 (195)
T ss_pred             ccccccCCCcccccccccc
Confidence            3459999999999999988


No 34 
>KOG3116 consensus Predicted C3H1-type Zn-finger protein [General function prediction only]
Probab=30.16  E-value=14  Score=30.14  Aligned_cols=19  Identities=32%  Similarity=0.807  Sum_probs=14.8

Q ss_pred             CccccccCCCCccCCCCCC
Q 026649          186 DVICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       186 ~~~C~~C~~~gH~~rdC~~  204 (235)
                      .+.|-+|-+.|||..+|.+
T Consensus        27 ~~rCQKClq~GHWtYECk~   45 (177)
T KOG3116|consen   27 SARCQKCLQAGHWTYECKN   45 (177)
T ss_pred             chhHHHHHhhccceeeecC
Confidence            4678888888888888865


No 35 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=24.37  E-value=46  Score=26.25  Aligned_cols=19  Identities=32%  Similarity=0.656  Sum_probs=12.2

Q ss_pred             cCccccccCCCCccCCCCCC
Q 026649          185 HDVICRSCNQMGHMSRDCVG  204 (235)
Q Consensus       185 ~~~~C~~C~~~gH~~rdC~~  204 (235)
                      ..++|+.|+ -.||...||-
T Consensus       105 ~~v~CR~Ck-GdH~T~~CPy  123 (128)
T PF12353_consen  105 SKVKCRICK-GDHWTSKCPY  123 (128)
T ss_pred             ceEEeCCCC-CCcccccCCc
Confidence            446677774 5677777763


No 36 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=20.89  E-value=60  Score=25.59  Aligned_cols=22  Identities=27%  Similarity=0.641  Sum_probs=18.2

Q ss_pred             CCcceecCCCCCcCCCCCCCCCC
Q 026649          205 PLIICRNCGGRGHMAYECPSGRI  227 (235)
Q Consensus       205 ~~~~C~~Cg~~GH~~~~Cp~~~~  227 (235)
                      ..+.|..|+ -.||...||....
T Consensus       105 ~~v~CR~Ck-GdH~T~~CPyKd~  126 (128)
T PF12353_consen  105 SKVKCRICK-GDHWTSKCPYKDT  126 (128)
T ss_pred             ceEEeCCCC-CCcccccCCcccc
Confidence            469999996 6899999997543


Done!