Citrus Sinensis ID: 026655
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 235 | 2.2.26 [Sep-21-2011] | |||||||
| Q9SZ46 | 524 | Cytochrome P450 82C4 OS=A | yes | no | 0.982 | 0.440 | 0.573 | 1e-74 | |
| O49396 | 512 | Cytochrome P450 82C3 OS=A | no | no | 0.982 | 0.451 | 0.581 | 3e-74 | |
| O49394 | 523 | Cytochrome P450 82C2 OS=A | no | no | 0.991 | 0.445 | 0.565 | 5e-72 | |
| O49858 | 527 | Cytochrome P450 82A3 OS=G | no | no | 0.991 | 0.442 | 0.542 | 2e-70 | |
| Q43068 | 544 | Cytochrome P450 82A1 (Fra | N/A | no | 0.991 | 0.428 | 0.529 | 3e-67 | |
| O49859 | 525 | Cytochrome P450 82A4 OS=G | no | no | 0.982 | 0.44 | 0.540 | 2e-66 | |
| O81972 | 522 | Cytochrome P450 82A2 OS=G | no | no | 0.991 | 0.446 | 0.517 | 4e-63 | |
| Q9LSF8 | 515 | Cytochrome P450 82G1 OS=A | no | no | 0.987 | 0.450 | 0.5 | 1e-60 | |
| Q9SD85 | 513 | Flavonoid 3'-monooxygenas | no | no | 0.987 | 0.452 | 0.450 | 7e-55 | |
| O04773 | 523 | Flavonoid 3',5'-hydroxyla | N/A | no | 0.931 | 0.418 | 0.432 | 1e-52 |
| >sp|Q9SZ46|C82C4_ARATH Cytochrome P450 82C4 OS=Arabidopsis thaliana GN=CYP82C4 PE=2 SV=1 | Back alignment and function desciption |
|---|
Score = 279 bits (713), Expect = 1e-74, Method: Compositional matrix adjust.
Identities = 137/239 (57%), Positives = 174/239 (72%), Gaps = 8/239 (3%)
Query: 1 MSVMLSILSDTK----QYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDIL 56
+ VM+S+ K QY D +T K+TCL L+L +DT+ TLTW ISLLLN +++L
Sbjct: 288 IDVMMSLAEQGKLSHLQY---DANTSIKSTCLALILGGSDTSASTLTWAISLLLNNKEML 344
Query: 57 NKAQNELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYN 116
KAQ+E+DI VG R V +SDI+NLVYLQAI+KE +RLYPA PLL P E++E+CT++GY
Sbjct: 345 KKAQDEIDIHVGRDRNVEDSDIENLVYLQAIIKETLRLYPAGPLLGPREAMEDCTVAGYY 404
Query: 117 VPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLT-RHKDIDVRGQNFELLPFGSGRRICP 175
VP T+LI+NVWK+QRDP V+ EP +F+PERF+T K+ DVRGQNFEL+PFGSGRR CP
Sbjct: 405 VPCGTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKEFDVRGQNFELMPFGSGRRSCP 464
Query: 176 GVSFALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRLSASLY 234
G S A+QV+ LA LH FD T + P DM E GLTI KA PLEVLI+PR+ L+
Sbjct: 465 GSSLAMQVLHLGLARFLHSFDVKTVMDMPVDMSENPGLTIPKATPLEVLISPRIKEELF 523
|
Can hydroxylates 8-methoxypsoralen to form 5-hydroxy-8-methoxypsoralen in vivo and in vitro. Involved in the early iron deficiency response, possibly through an IDE1-like mediated pathway. Arabidopsis thaliana (taxid: 3702) EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: - |
| >sp|O49396|C82C3_ARATH Cytochrome P450 82C3 OS=Arabidopsis thaliana GN=CYP82C3 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|O49394|C82C2_ARATH Cytochrome P450 82C2 OS=Arabidopsis thaliana GN=CYP82C2 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O49858|C82A3_SOYBN Cytochrome P450 82A3 OS=Glycine max GN=CYP82A3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q43068|C82A1_PEA Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O49859|C82A4_SOYBN Cytochrome P450 82A4 OS=Glycine max GN=CYP82A4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O81972|C82A2_SOYBN Cytochrome P450 82A2 OS=Glycine max GN=CYP82A2 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LSF8|C82G1_ARATH Cytochrome P450 82G1 OS=Arabidopsis thaliana GN=CYP82G1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O04773|C75A6_CAMME Flavonoid 3',5'-hydroxylase OS=Campanula medium GN=CYP75A6 PE=2 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 235 | ||||||
| 225458465 | 527 | PREDICTED: cytochrome P450 82C4 [Vitis v | 0.995 | 0.444 | 0.628 | 1e-82 | |
| 359492645 | 731 | PREDICTED: cytochrome P450 82A3 [Vitis v | 0.995 | 0.320 | 0.607 | 2e-82 | |
| 224137290 | 538 | cytochrome P450 [Populus trichocarpa] gi | 1.0 | 0.436 | 0.622 | 5e-82 | |
| 297745692 | 543 | unnamed protein product [Vitis vinifera] | 0.991 | 0.429 | 0.608 | 1e-81 | |
| 225468906 | 528 | PREDICTED: cytochrome P450 82C4 [Vitis v | 0.991 | 0.441 | 0.608 | 1e-81 | |
| 224137286 | 465 | cytochrome P450 [Populus trichocarpa] gi | 1.0 | 0.505 | 0.618 | 2e-81 | |
| 255538496 | 528 | cytochrome P450, putative [Ricinus commu | 0.995 | 0.443 | 0.591 | 2e-81 | |
| 449476760 | 532 | PREDICTED: LOW QUALITY PROTEIN: cytochro | 0.995 | 0.439 | 0.594 | 3e-81 | |
| 449460139 | 532 | PREDICTED: cytochrome P450 82C4-like [Cu | 0.995 | 0.439 | 0.594 | 4e-81 | |
| 224137298 | 342 | cytochrome P450 [Populus trichocarpa] gi | 0.995 | 0.684 | 0.658 | 7e-81 |
| >gi|225458465|ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|302142392|emb|CBI19595.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 311 bits (798), Expect = 1e-82, Method: Compositional matrix adjust.
Identities = 149/237 (62%), Positives = 181/237 (76%), Gaps = 3/237 (1%)
Query: 1 MSVMLSILSDTKQYSG--RDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNK 58
+ VMLS L + + SG D +T K+TCL L+L +DTT TLTW ISLLLN R L K
Sbjct: 291 IDVMLS-LQEEGRLSGFQYDSETSIKSTCLALILGGSDTTAGTLTWAISLLLNNRHALKK 349
Query: 59 AQNELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNVP 118
AQ ELD+ VG +RQV ESD+KNLVYLQAI+KE +RLYPA PLL P E++++CT++GYNVP
Sbjct: 350 AQEELDLCVGMERQVEESDVKNLVYLQAIIKETLRLYPAGPLLGPREALDDCTVAGYNVP 409
Query: 119 TSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRICPGVS 178
T+LI+N+WKLQRDP VW PC FQPERFL H D+DV+GQ FEL+PFGSGRR CPGVS
Sbjct: 410 AGTRLIVNIWKLQRDPSVWTNPCAFQPERFLNAHADVDVKGQQFELMPFGSGRRSCPGVS 469
Query: 179 FALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRLSASLYG 235
FALQV+ TLA LLH F+ +TP ++P DM E GLTI KA PLEVL+ PRL++ LY
Sbjct: 470 FALQVLHLTLARLLHAFELSTPVDQPVDMTESSGLTIPKATPLEVLLTPRLNSKLYA 526
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|359492645|ref|XP_002281995.2| PREDICTED: cytochrome P450 82A3 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224137290|ref|XP_002327089.1| cytochrome P450 [Populus trichocarpa] gi|222835404|gb|EEE73839.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297745692|emb|CBI40977.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225468906|ref|XP_002268915.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera] gi|147794787|emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224137286|ref|XP_002327088.1| cytochrome P450 [Populus trichocarpa] gi|222835403|gb|EEE73838.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255538496|ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis] gi|223551014|gb|EEF52500.1| cytochrome P450, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449476760|ref|XP_004154826.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 82C4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449460139|ref|XP_004147803.1| PREDICTED: cytochrome P450 82C4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224137298|ref|XP_002327091.1| cytochrome P450 [Populus trichocarpa] gi|222835406|gb|EEE73841.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 235 | ||||||
| TAIR|locus:2116622 | 512 | CYP82C3 ""cytochrome P450, fam | 0.995 | 0.457 | 0.529 | 3.1e-60 | |
| TAIR|locus:2116607 | 524 | CYP82C4 ""cytochrome P450, fam | 0.995 | 0.446 | 0.516 | 8.1e-60 | |
| TAIR|locus:2116652 | 523 | CYP82C2 ""cytochrome P450, fam | 0.995 | 0.447 | 0.512 | 3.2e-58 | |
| TAIR|locus:2090275 | 515 | CYP82G1 "cytochrome P450, fami | 0.987 | 0.450 | 0.444 | 1.2e-47 | |
| TAIR|locus:2040174 | 527 | CYP82F1 ""cytochrome P450, fam | 0.995 | 0.444 | 0.419 | 4.8e-46 | |
| TAIR|locus:2142878 | 513 | TT7 "TRANSPARENT TESTA 7" [Ara | 1.0 | 0.458 | 0.410 | 7.9e-46 | |
| TAIR|locus:2139099 | 520 | CYP706A5 ""cytochrome P450, fa | 0.757 | 0.342 | 0.469 | 1.5e-42 | |
| TAIR|locus:2139114 | 518 | CYP706A6 ""cytochrome P450, fa | 0.765 | 0.347 | 0.461 | 4e-42 | |
| TAIR|locus:2043605 | 512 | CYP76C2 ""cytochrome P450, fam | 0.702 | 0.322 | 0.5 | 8.4e-42 | |
| TAIR|locus:2043614 | 515 | CYP76C3 ""cytochrome P450, fam | 0.731 | 0.333 | 0.511 | 2.2e-41 |
| TAIR|locus:2116622 CYP82C3 ""cytochrome P450, family 82, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 617 (222.3 bits), Expect = 3.1e-60, P = 3.1e-60
Identities = 125/236 (52%), Positives = 155/236 (65%)
Query: 1 MSVMLSILSDTK-QYSGRDVDTINKATCLGXXXXXXXXXXXXXXXXXXXXXNYRDILNKA 59
+ VMLS+ K + D +T K TCL N +D+L K
Sbjct: 276 VDVMLSLAEQGKLSHLQYDANTCIKTTCLALILGGSETSPSTLTWAISLLLNNKDMLKKV 335
Query: 60 QNELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNVPT 119
Q+E+DI VG R V +SDIKNLVYLQAI+KE +RLYPAAPLL E++E+CT++GYNVP
Sbjct: 336 QDEIDIHVGRDRNVEDSDIKNLVYLQAIIKETLRLYPAAPLLGHREAMEDCTVAGYNVPC 395
Query: 120 STQLIINVWKLQRDPHVWEEPCKFQPERFLTRH-KDIDVRGQNFELLPFGSGRRICPGVS 178
T+LI+NVWK+QRDP V+ EP +F+PERF+T KD DVRGQNFEL+PFGSGRR CPG S
Sbjct: 396 GTRLIVNVWKIQRDPKVYMEPNEFRPERFITGEAKDFDVRGQNFELMPFGSGRRSCPGPS 455
Query: 179 FALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRLSASLY 234
A+Q++ LA LH F+ T + P DM E GLTI KA PLEVLI PRL L+
Sbjct: 456 LAMQMLHLGLARFLHSFEVKTVLDRPVDMSESPGLTITKATPLEVLINPRLKRELF 511
|
|
| TAIR|locus:2116607 CYP82C4 ""cytochrome P450, family 82, subfamily C, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2116652 CYP82C2 ""cytochrome P450, family 82, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2090275 CYP82G1 "cytochrome P450, family 82, subfamily G, polypeptide 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2040174 CYP82F1 ""cytochrome P450, family 82, subfamily F, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139099 CYP706A5 ""cytochrome P450, family 706, subfamily A, polypeptide 5"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2139114 CYP706A6 ""cytochrome P450, family 706, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 235 | |||
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 5e-79 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 1e-67 | |
| PLN03112 | 514 | PLN03112, PLN03112, cytochrome P450 family protein | 2e-58 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 1e-55 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 2e-51 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 2e-51 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 2e-49 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 6e-45 | |
| PLN02971 | 543 | PLN02971, PLN02971, tryptophan N-hydroxylase | 3e-38 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 3e-36 | |
| PLN03018 | 534 | PLN03018, PLN03018, homomethionine N-hydroxylase | 2e-34 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 1e-33 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 5e-33 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 7e-31 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 6e-27 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 4e-26 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 1e-20 | |
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 5e-17 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 2e-12 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 2e-11 | |
| PLN02196 | 463 | PLN02196, PLN02196, abscisic acid 8'-hydroxylase | 4e-10 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 6e-10 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 2e-07 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 5e-07 | |
| PLN02774 | 463 | PLN02774, PLN02774, brassinosteroid-6-oxidase | 3e-06 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 3e-04 |
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
Score = 245 bits (628), Expect = 5e-79
Identities = 110/243 (45%), Positives = 155/243 (63%), Gaps = 9/243 (3%)
Query: 1 MSVMLSILSDTKQYSGRDV---DTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILN 57
+S +L+ L +Q G DT KA L L A TDTT+ T+ W I+ L+ + DIL
Sbjct: 274 LSTLLA-LKREQQADGEGGRITDTEIKALLLNLFTAGTDTTSSTVEWAIAELIRHPDILK 332
Query: 58 KAQNELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNV 117
KAQ ELD +VG R V+ESD+ L YLQA++KE RL+P+ PL +P + EEC I+GY++
Sbjct: 333 KAQEELDAVVGRDRLVSESDLPQLTYLQAVIKETFRLHPSTPLSLPRMAAEECEINGYHI 392
Query: 118 PTSTQLIINVWKLQRDPHVWEEPCKFQPERFLT--RHKDIDVRGQNFELLPFGSGRRICP 175
P L++NVW + RDP W +P +F+P+RFL H +DV+G +FEL+PFG+GRRIC
Sbjct: 393 PKGATLLVNVWAIARDPEQWPDPLEFRPDRFLPGGEHAGVDVKGSDFELIPFGAGRRICA 452
Query: 176 GVSFALQVMEFTLASLLHGFDFATPSNEPPD---MGEGIGLTIEKARPLEVLIAPRLSAS 232
G+S+ L+++ A+L+H FD+ + PD M E GLT+++A PL V PRL S
Sbjct: 453 GLSWGLRMVTLLTATLVHAFDWELADGQTPDKLNMEEAYGLTLQRAVPLMVHPRPRLLPS 512
Query: 233 LYG 235
YG
Sbjct: 513 AYG 515
|
Length = 517 |
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 235 | |||
| KOG0156 | 489 | consensus Cytochrome P450 CYP2 subfamily [Secondar | 100.0 | |
| KOG0158 | 499 | consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf | 100.0 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 100.0 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 100.0 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 100.0 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 100.0 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 100.0 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 100.0 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 100.0 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 100.0 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 100.0 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 100.0 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 100.0 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 100.0 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 100.0 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 100.0 | |
| KOG0157 | 497 | consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami | 100.0 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 100.0 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 100.0 | |
| PLN02655 | 466 | ent-kaurene oxidase | 100.0 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 100.0 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 100.0 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 100.0 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 100.0 | |
| KOG0159 | 519 | consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 | 100.0 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 100.0 | |
| KOG0684 | 486 | consensus Cytochrome P450 [Secondary metabolites b | 100.0 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 100.0 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 100.0 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 100.0 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 100.0 | |
| PLN02648 | 480 | allene oxide synthase | 100.0 |
| >KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.8e-54 Score=375.70 Aligned_cols=222 Identities=45% Similarity=0.826 Sum_probs=201.0
Q ss_pred ChhhhchhccccccCCCChhhhHHHHHHHHHhhchhhHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhcCCCCCCHHhhhc
Q 026655 1 MSVMLSILSDTKQYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNKAQNELDILVGAKRQVNESDIKN 80 (235)
Q Consensus 1 ~d~ll~~~~~~~~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~~~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~ 80 (235)
+|.||++..+.++.+ +++++|.+.+.++++||+|||++++.|++.+|++||++|+|+++||+++++.++.++.+++.+
T Consensus 267 vD~lL~~~~~~~~~~--~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~~ 344 (489)
T KOG0156|consen 267 VDALLKLMKEEKAEG--LTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLPK 344 (489)
T ss_pred HHHHHHhhcccccCC--CCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhcc
Confidence 467777655543222 999999999999999999999999999999999999999999999999999988899999999
Q ss_pred chhHHHHHHHHhcCCCCCCccccccccccccccceEeCCCCEEEEchhhhccCCCCCCCCCCCCCCccCCCcCCccccCC
Q 026655 81 LVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQ 160 (235)
Q Consensus 81 ~~~l~a~i~E~lRl~~~~~~~~~r~~~~d~~i~~~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~ 160 (235)
+|||+|||+|++|+||++|...+|.+++|+.++||.|||||.|+++.|++|+||++|+||++|+||||++++ +..+.
T Consensus 345 lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~---d~~~~ 421 (489)
T KOG0156|consen 345 LPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSN---DGKGL 421 (489)
T ss_pred CHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCc---cccCC
Confidence 999999999999999999999999999999999999999999999999999999999999999999999974 11225
Q ss_pred ccceeccCCCCCCCccHHHHHHHHHHHHHHHHHhcceeCCCCCCCCCCcccceeeccCCCeEEEEeecC
Q 026655 161 NFELLPFGSGRRICPGVSFALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRL 229 (235)
Q Consensus 161 ~~~~~~Fg~G~r~C~G~~lA~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~ 229 (235)
...++|||.|+|+|||..+|++++.++++.|+++|+|+.+++ .+++.+. ++++..+.|+.+...+|.
T Consensus 422 ~~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~-~~d~~e~-~~~~~~~~pl~~~~~~r~ 488 (489)
T KOG0156|consen 422 DFKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGG-KVDMEEA-GLTLKKKKPLKAVPVPRL 488 (489)
T ss_pred ceEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCC-CCCCccc-ccceecCCcceeeeecCC
Confidence 778999999999999999999999999999999999999987 6677766 466667778888888774
|
|
| >KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 235 | ||||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 8e-24 | ||
| 3pm0_A | 507 | Structural Characterization Of The Complex Between | 2e-22 | ||
| 3qm4_A | 479 | Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl | 4e-21 | ||
| 2f9q_A | 479 | Crystal Structure Of Human Cytochrome P450 2d6 Leng | 6e-21 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 8e-21 | ||
| 4i8v_A | 491 | Human Cytochrome P450 1a1 In Complex With Alpha-nap | 1e-20 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 4e-19 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 4e-19 | ||
| 3qz1_A | 496 | Crystal Structure Of Bovine Steroid Of 21-Hydroxyla | 6e-18 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 3e-17 | ||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 4e-17 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 4e-17 | ||
| 3k9v_A | 482 | Crystal Structure Of Rat Mitochondrial P450 24a1 S5 | 9e-16 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 1e-14 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 6e-14 | ||
| 3tk3_A | 476 | Cytochrome P450 2b4 Mutant L437a In Complex With 4- | 2e-13 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 3e-13 | ||
| 1suo_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 With Bou | 4e-13 | ||
| 4h1n_A | 479 | Crystal Structure Of P450 2b4 F297a Mutant In Compl | 4e-13 | ||
| 1po5_A | 476 | Structure Of Mammalian Cytochrome P450 2b4 Length = | 4e-13 | ||
| 2q6n_A | 478 | Structure Of Cytochrome P450 2b4 With Bound 1-(4- C | 4e-13 | ||
| 3ibd_A | 476 | Crystal Structure Of A Cytochrome P450 2b6 Genetic | 7e-13 | ||
| 3e4e_A | 476 | Human Cytochrome P450 2e1 In Complex With The Inhib | 2e-12 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 3e-12 | ||
| 4du2_B | 470 | Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin | 3e-12 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 3e-12 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 3e-12 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 3e-12 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 4e-12 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 4e-12 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 4e-12 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 4e-12 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 4e-12 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 4e-12 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 4e-12 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 4e-12 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 4e-12 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 4e-12 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 4e-12 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 4e-12 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 4e-12 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 4e-12 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 4e-12 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 4e-12 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 4e-12 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 4e-12 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 4e-12 | ||
| 4dtw_B | 469 | Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto | 5e-12 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 7e-12 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 7e-12 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 8e-12 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 8e-12 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 8e-12 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 9e-12 | ||
| 1zo4_A | 473 | Crystal Structure Of A328s Mutant Of The Heme Domai | 9e-12 | ||
| 3qi8_B | 472 | Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) | 1e-11 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 1e-11 | ||
| 1zoa_A | 473 | Crystal Structure Of A328v Mutant Of The Heme Domai | 1e-11 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-11 | ||
| 4dub_A | 472 | Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami | 2e-11 | ||
| 4dua_A | 471 | Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng | 2e-11 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 3e-11 | ||
| 2p85_A | 476 | Structure Of Human Lung Cytochrome P450 2a13 With I | 3e-11 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 4e-11 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 8e-11 | ||
| 1r9o_A | 477 | Crystal Structure Of P4502c9 With Flurbiprofen Boun | 2e-10 | ||
| 1og2_A | 475 | Structure Of Human Cytochrome P450 Cyp2c9 Length = | 2e-10 | ||
| 1pq2_A | 476 | Crystal Structure Of Human Drug Metabolizing Cytoch | 5e-10 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 6e-10 | ||
| 1ea1_A | 455 | Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) | 1e-09 | ||
| 1u13_A | 455 | Crystal Structure Analysis Of The C37lC151TC442A-Tr | 2e-09 | ||
| 1x8v_A | 455 | Estriol-Bound And Ligand-Free Structures Of Sterol | 2e-09 | ||
| 2w0a_A | 455 | Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( | 2e-09 | ||
| 1dt6_A | 473 | Structure Of Mammalian Cytochrome P450 2c5 Length = | 2e-09 | ||
| 3na0_A | 471 | Crystal Structure Of Human Cyp11a1 In Complex With | 2e-09 | ||
| 3n9y_A | 487 | Crystal Structure Of Human Cyp11a1 In Complex With | 3e-09 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 3e-09 | ||
| 3mzs_A | 486 | Crystal Structure Of Cytochrome P450 Cyp11a1 In Com | 4e-09 | ||
| 4dvq_A | 483 | Structure Of Human Aldosterone Synthase, Cyp11b2, I | 7e-09 | ||
| 2pg6_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 L240 | 9e-09 | ||
| 1z10_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 With | 1e-08 | ||
| 2pg7_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 1e-08 | ||
| 2pg5_A | 476 | Crystal Structure Of Human Microsomal P450 2a6 N297 | 1e-08 | ||
| 3ebs_A | 476 | Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C | 1e-08 | ||
| 1izo_A | 417 | Cytochrome P450 Bs Beta Complexed With Fatty Acid L | 1e-08 | ||
| 3eqm_A | 503 | Crystal Structure Of Human Placental Aromatase Cyto | 2e-08 | ||
| 3awp_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len | 4e-08 | ||
| 3vno_A | 407 | Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len | 6e-08 | ||
| 3vm4_A | 407 | Cytochrome P450sp Alpha (Cyp152b1) In Complex With | 7e-08 | ||
| 3voo_A | 407 | Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len | 7e-08 | ||
| 3awm_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P | 8e-08 | ||
| 3awq_A | 415 | Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng | 8e-08 | ||
| 3dax_A | 491 | Crystal Structure Of Human Cyp7a1 Length = 491 | 8e-06 | ||
| 3sn5_A | 491 | Crystal Structure Of Human Cyp7a1 In Complex With C | 8e-06 | ||
| 3r9c_A | 418 | Crystal Structure Of Mycobacterium Smegmatis Cyp164 | 2e-05 | ||
| 1wiy_A | 389 | Crystal Structure Analysis Of A 6-Coordinated Cytoc | 4e-05 | ||
| 3b98_A | 475 | Crystal Structure Of Zebrafish Prostacyclin Synthas | 5e-05 | ||
| 1n97_A | 389 | Crystal Stucture Of Cyp175a1 From Thermus Thermophi | 7e-04 |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
|
| >pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 | Back alignment and structure |
| >pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 | Back alignment and structure |
| >pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
| >pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 | Back alignment and structure |
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 | Back alignment and structure |
| >pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 | Back alignment and structure |
| >pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 | Back alignment and structure |
| >pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 | Back alignment and structure |
| >pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 | Back alignment and structure |
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 | Back alignment and structure |
| >pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 | Back alignment and structure |
| >pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 | Back alignment and structure |
| >pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 | Back alignment and structure |
| >pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 | Back alignment and structure |
| >pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 | Back alignment and structure |
| >pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 | Back alignment and structure |
| >pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 | Back alignment and structure |
| >pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 | Back alignment and structure |
| >pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 | Back alignment and structure |
| >pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 | Back alignment and structure |
| >pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 | Back alignment and structure |
| >pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 | Back alignment and structure |
| >pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 | Back alignment and structure |
| >pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 | Back alignment and structure |
| >pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 | Back alignment and structure |
| >pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 | Back alignment and structure |
| >pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 | Back alignment and structure |
| >pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 | Back alignment and structure |
| >pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 | Back alignment and structure |
| >pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 | Back alignment and structure |
| >pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 | Back alignment and structure |
| >pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 | Back alignment and structure |
| >pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 | Back alignment and structure |
| >pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 | Back alignment and structure |
| >pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 | Back alignment and structure |
| >pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 | Back alignment and structure |
| >pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 | Back alignment and structure |
| >pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 | Back alignment and structure |
| >pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 | Back alignment and structure |
| >pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
Score = 268 bits (687), Expect = 2e-88
Identities = 56/248 (22%), Positives = 95/248 (38%), Gaps = 26/248 (10%)
Query: 1 MSVMLSILSDTKQYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNKAQ 60
+ + L D G D + +A L + WV+ LL + + L +
Sbjct: 237 LGSYVKQLQD----EGIDAEMQRRAM-LLQLWVTQGNAGPAAFWVMGYLLTHPEALRAVR 291
Query: 61 NELDILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTIS-----GY 115
E+ G K E KN ++L E +RL AA + + ++ I Y
Sbjct: 292 EEIQ---GGKHLRLEERQKNTPVFDSVLWETLRLTAAALI--TRDVTQDKKICLSNGQEY 346
Query: 116 NVPTSTQLIINVW-KLQRDPHVWEEPCKFQPERFL----TRHKDIDVRGQ--NFELLPFG 168
++ +L + + Q DP + ++P FQ +RFL T KD G + +P+G
Sbjct: 347 HLRRGDRLCVFPFISPQMDPQIHQQPEMFQFDRFLNADRTEKKDFFKNGARVKYPSVPWG 406
Query: 169 SGRRICPGVSFALQVMEFTLASLLHGFDFATPS---NEPPDMGEGIGLTI-EKARPLEVL 224
+ +CPG FA+ ++ + ++L FD P G I + A LE+
Sbjct: 407 TEDNLCPGRHFAVHAIKELVFTILTRFDVELCDKNATVPLVDPSRYGFGILQPAGDLEIR 466
Query: 225 IAPRLSAS 232
R
Sbjct: 467 YRIRFHHH 474
|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 235 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 100.0 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 100.0 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 100.0 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 100.0 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 100.0 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 100.0 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 100.0 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 100.0 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 100.0 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 100.0 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 100.0 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 100.0 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 100.0 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 100.0 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 100.0 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 100.0 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 100.0 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 100.0 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 100.0 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 100.0 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 100.0 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 100.0 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 100.0 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 100.0 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 100.0 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 100.0 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 100.0 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 100.0 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 100.0 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 100.0 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 100.0 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 100.0 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 100.0 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 100.0 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 100.0 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 100.0 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 100.0 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 100.0 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 100.0 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 100.0 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 100.0 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 100.0 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 100.0 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 100.0 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 100.0 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 100.0 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 100.0 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 100.0 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 100.0 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 100.0 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 100.0 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 100.0 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 100.0 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 100.0 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 100.0 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 100.0 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 100.0 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 100.0 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 100.0 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 100.0 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 100.0 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 100.0 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 100.0 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-54 Score=377.43 Aligned_cols=214 Identities=28% Similarity=0.499 Sum_probs=192.7
Q ss_pred ccCCCChhhhHHHHHHHHHhhchhhHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhcCCCCCCHHhhhcchhHHHHHHHHh
Q 026655 13 QYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNKAQNELDILVGAKRQVNESDIKNLVYLQAILKEAM 92 (235)
Q Consensus 13 ~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~~~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~l~a~i~E~l 92 (235)
+.+..++++++..++.++++||+|||+++++|++++|++||++|+|+++|++.+++.+..++.+++.++||++|||+|++
T Consensus 263 ~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~~l~~lpyl~avi~Etl 342 (479)
T 3tbg_A 263 NPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPYTTAVIHEVQ 342 (479)
T ss_dssp CTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHHHHTTCHHHHHHHHHHH
T ss_pred CCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchhhhccccccccceeeec
Confidence 34567999999999999999999999999999999999999999999999999998888999999999999999999999
Q ss_pred cCCCCCCccccccccccccccceEeCCCCEEEEchhhhccCCCCCCCCCCCCCCccCCCcCCccccCCccceeccCCCCC
Q 026655 93 RLYPAAPLLIPHESIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRR 172 (235)
Q Consensus 93 Rl~~~~~~~~~r~~~~d~~i~~~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~~~Fg~G~r 172 (235)
|++|+++...+|.+.+|++++|+.|||||.|+++.+++|+||++|+||++|+||||++.++.. ..+..|+|||+|+|
T Consensus 343 Rl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~---~~~~~~~pFG~G~R 419 (479)
T 3tbg_A 343 RFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHF---VKPEAFLPFSAGRR 419 (479)
T ss_dssp HHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCB---CCCTTCCTTCCSTT
T ss_pred cccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCccc---CCCCceecCCCCCc
Confidence 999999998777888999999999999999999999999999999999999999999876422 24678999999999
Q ss_pred CCccHHHHHHHHHHHHHHHHHhcceeCCCCCC-CCCCcccceeeccCCCeEEEEeecCC
Q 026655 173 ICPGVSFALQVMEFTLASLLHGFDFATPSNEP-PDMGEGIGLTIEKARPLEVLIAPRLS 230 (235)
Q Consensus 173 ~C~G~~lA~~~~~~~la~ll~~f~~~~~~~~~-~~~~~~~~~~~~~~~~~~v~~~~R~~ 230 (235)
.|+|++||++|+++++|.||++|+|+++++++ +......+++..| .++.|+++||+.
T Consensus 420 ~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P-~~~~v~~~pRs~ 477 (479)
T 3tbg_A 420 ACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSP-SPYELCAVPRHH 477 (479)
T ss_dssp SCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCCCCSCEEESSSEEE-CCCCBEEEEC--
T ss_pred CChhHHHHHHHHHHHHHHHHHccEEEeCCCCCCccccccceeeecC-CCeEEEEEECCC
Confidence 99999999999999999999999999988754 3333444556666 589999999974
|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 235 | ||||
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 7e-47 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 1e-44 | |
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 9e-43 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 2e-33 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 2e-29 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 9e-27 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 1e-21 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 3e-19 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 3e-18 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 7e-18 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 1e-17 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 2e-17 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 2e-15 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 3e-15 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 6e-15 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 1e-14 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 1e-14 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 7e-14 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 1e-13 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 1e-13 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 2e-11 |
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome p450 2b4 species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]
Score = 159 bits (402), Expect = 7e-47
Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 4/226 (1%)
Query: 4 MLSILSDTKQYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNKAQNEL 63
+L + D S T L L A T+TT+ TL + L+L Y + + Q E+
Sbjct: 242 LLRMEKDKSDPSSEFHHQNLILTVLSLFFAGTETTSTTLRYGFLLMLKYPHVTERVQKEI 301
Query: 64 DILVGAKRQVNESDIKNLVYLQAILKEAMRLYPAAPLLIPHESIEECTISGYNVPTSTQL 123
+ ++G+ R D + Y A++ E RL P +PH ++ GY +P +T++
Sbjct: 302 EQVIGSHRPPALDDRAKMPYTDAVIHEIQRLGDLIPFGVPHTVTKDTQFRGYVIPKNTEV 361
Query: 124 IINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRRICPGVSFALQV 183
+ DP +E P F P FL + + +N +PF G+RIC G A
Sbjct: 362 FPVLSSALHDPRYFETPNTFNPGHFLDANGALK---RNEGFMPFSLGKRICLGEGIARTE 418
Query: 184 MEFTLASLLHGFDFATP-SNEPPDMGEGIGLTIEKARPLEVLIAPR 228
+ ++L F A+P E D+ ++ R
Sbjct: 419 LFLFFTTILQNFSIASPVPPEDIDLTPRESGVGNVPPSYQIRFLAR 464
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 235 | |||
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 100.0 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 100.0 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 100.0 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 100.0 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 100.0 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 100.0 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 100.0 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 100.0 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 100.0 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 100.0 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 100.0 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 100.0 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 100.0 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 100.0 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 100.0 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 100.0 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 100.0 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.98 |
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Vitamin D 25-hydroxylase Cyp2R1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.9e-51 Score=355.23 Aligned_cols=213 Identities=29% Similarity=0.500 Sum_probs=196.1
Q ss_pred ccCCCChhhhHHHHHHHHHhhchhhHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhcCCCCCCHHhhhcchhHHHHHHHHh
Q 026655 13 QYSGRDVDTINKATCLGLVLAATDTTTITLTWVISLLLNYRDILNKAQNELDILVGAKRQVNESDIKNLVYLQAILKEAM 92 (235)
Q Consensus 13 ~~~~~l~~~~i~~~~~~~~~ag~~tt~~~l~~~~~~l~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~~~~~l~a~i~E~l 92 (235)
..+..++++++.+++..+++||++||+.+++|++++|++||++|+++++|++.+.++...++.+++.++|||+||++|++
T Consensus 251 ~~~~~~s~~~i~~~~~~~l~ag~~tt~~~l~~~l~~L~~~P~~~~kl~~Ei~~~~~~~~~~~~~~l~~lp~l~a~~~Et~ 330 (463)
T d3czha1 251 DPSSTFSKENLIFSVGELIIAGTETTTNVLRWAILFMALYPNIQGQVQKEIDLIMGPNGKPSWDDKCKMPYTEAVLHEVL 330 (463)
T ss_dssp CTTCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGGGCHHHHHHHHHHH
T ss_pred cccchhHHHHHHHHHHHHHhhhhccchhhhhhHHHhhccCcHHHHHHHHHHHhhcCCCCCCCHHHHHhhhhcccccceee
Confidence 45677999999999999999999999999999999999999999999999999999888899999999999999999999
Q ss_pred cCCCCCCccccccccccccccceEeCCCCEEEEchhhhccCCCCCCCCCCCCCCccCCCcCCccccCCccceeccCCCCC
Q 026655 93 RLYPAAPLLIPHESIEECTISGYNVPTSTQLIINVWKLQRDPHVWEEPCKFQPERFLTRHKDIDVRGQNFELLPFGSGRR 172 (235)
Q Consensus 93 Rl~~~~~~~~~r~~~~d~~i~~~~ip~g~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~~~~~~~~~~~~~~~Fg~G~r 172 (235)
|++|+++....|.+.+|+.++|+.||||+.|+++.+++|+||++|+||++|+|+||++.+.. ...+..|+|||+|+|
T Consensus 331 Rl~~~~~~~~~r~~~~~~~~~g~~ipkG~~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~---~~~~~~~~~FG~G~r 407 (463)
T d3czha1 331 RFCNIVPLGIFHATSEDAVVRGYSIPKGTTVITNLYSVHFDEKYWRDPEVFHPERFLDSSGY---FAKKEALVPFSLGRR 407 (463)
T ss_dssp HHHCSSTTCSCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTCSSTTSCCGGGGBCTTSC---BCCCTTCCTTCCSTT
T ss_pred eeeccccccceecccCCcccCCcEECCCCcccCcHHHhhCCcccCCChhhcCccccCCCccc---cCCCCceeCCCCCCc
Confidence 99999988778999999999999999999999999999999999999999999999987632 224678999999999
Q ss_pred CCccHHHHHHHHHHHHHHHHHhcceeCCCCCCCCCCcccceeeccCCCeEEEEeecC
Q 026655 173 ICPGVSFALQVMEFTLASLLHGFDFATPSNEPPDMGEGIGLTIEKARPLEVLIAPRL 229 (235)
Q Consensus 173 ~C~G~~lA~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~R~ 229 (235)
.|+|++||++|+++++|.||++|+|+++++..++++...+++++| .++.|++++|.
T Consensus 408 ~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p-~~~~v~~~~R~ 463 (463)
T d3czha1 408 HCLGEHLARMEMFLFFTALLQRFHLHFPHELVPDLKPRLGMTLQP-QPYLICAERRH 463 (463)
T ss_dssp CCTTHHHHHHHHHHHHHHHHHHEEEECGGGCCCCCCCCSSSSCCC-CCCCBEEEECC
T ss_pred CCchHHHHHHHHHHHHHHHHHhcEEEeCCCCCCCceeccCeEEec-cCcEEEEEeCc
Confidence 999999999999999999999999999877666777777777766 48899999984
|
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|