BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026668
(235 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3UW2|A Chain A, X-Ray Crystal Structure Of
PhosphoglucomutasePHOSPHOMANNOMUTASE Family Protein
(Bth_i1489)from Burkholderia Thailandensis
Length = 485
Score = 26.9 bits (58), Expect = 9.2, Method: Compositional matrix adjust.
Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
Query: 70 LLKILRSVAESDSTIHFFCQSQSVPELQVVPVLFQHSFKEDSV--DERVTSLDHIFTVDP 127
LL+IL VA+ + ++ + S PELQ+ ++ D + D + D + T+D
Sbjct: 371 LLEILARVADPSALLNGLPNAVSTPELQLKLEEGENVKLIDKLRADAKFDGADEVVTIDG 430
Query: 128 MRVTSP 133
+RV P
Sbjct: 431 LRVEYP 436
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.135 0.376
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,257,186
Number of Sequences: 62578
Number of extensions: 167107
Number of successful extensions: 319
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 317
Number of HSP's gapped (non-prelim): 3
length of query: 235
length of database: 14,973,337
effective HSP length: 96
effective length of query: 139
effective length of database: 8,965,849
effective search space: 1246253011
effective search space used: 1246253011
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)