BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026668
         (235 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3UW2|A Chain A, X-Ray Crystal Structure Of
           PhosphoglucomutasePHOSPHOMANNOMUTASE Family Protein
           (Bth_i1489)from Burkholderia Thailandensis
          Length = 485

 Score = 26.9 bits (58), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 2/66 (3%)

Query: 70  LLKILRSVAESDSTIHFFCQSQSVPELQVVPVLFQHSFKEDSV--DERVTSLDHIFTVDP 127
           LL+IL  VA+  + ++    + S PELQ+     ++    D +  D +    D + T+D 
Sbjct: 371 LLEILARVADPSALLNGLPNAVSTPELQLKLEEGENVKLIDKLRADAKFDGADEVVTIDG 430

Query: 128 MRVTSP 133
           +RV  P
Sbjct: 431 LRVEYP 436


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.376 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,257,186
Number of Sequences: 62578
Number of extensions: 167107
Number of successful extensions: 319
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 317
Number of HSP's gapped (non-prelim): 3
length of query: 235
length of database: 14,973,337
effective HSP length: 96
effective length of query: 139
effective length of database: 8,965,849
effective search space: 1246253011
effective search space used: 1246253011
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)