Citrus Sinensis ID: 026672


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----
MEFVSPEGLRLDGRRPTEMRQLRAEIGNVAKADGSAVFEMGNTKVIAAVYGPREVQNKSQQMSDQALVRCEYSMANFSTGDRMRKPKGDRRSTEISLVIRQTMEACILTHLMPRSQIDIFVQVLQADGGTRSACINAATLALQDAGIPMRDIVTSCSAGYLNSTPLLDSAGGPDVTVGILPTLDKVTLLQMDAKLPTNTFEDVMQLAIEGCKAVANYIREVLLENTKQLECRRGL
ccEEcccccccccccccccccEEEEEccccccccEEEEEEccEEEEEEEEcccccccccccccccEEEEEEEECccccccccccccccccHHHHHHHHHHHHHHHHHccccccccEEEEEEEEECcccccHHHHHHHHHHHHHHccccccccEEEEEEEEEccEEEEccccccccCEEEccccccEEEEEECccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MEFVSPEGLRLDGRRPTEMRQLRAEIGNVAKADGSAVFEMGNTKVIAAVYG***************LVRCEYSMAN******************ISLVIRQTMEACILTHLMPRSQIDIFVQVLQADGGTRSACINAATLALQDAGIPMRDIVTSCSAGYLNSTPLLDSAGGPDVTVGILPTLDKVTLLQMDAKLPTNTFEDVMQLAIEGCKAVANYIREVLLENTKQ*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFVSPEGLRLDGRRPTEMRQLRAEIGNVAKADGSAVFEMGNTKVIAAVYGPREVQNKSQQMSDQALVRCEYSMANFSTGDRMRKPKGDRRSTEISLVIRQTMEACILTHLMPRSQIDIFVQVLQADGGTRSACINAATLALQDAGIPMRDIVTSCSAGYLNSTPLLDSAGGPDVTVGILPTLDKVTLLQMDAKLPTNTFEDVMQLAIEGCKAVANYIREVLLENTKQLECRRGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable exosome complex exonuclease 1 Probably involved in the 3'->5' degradation of a variety of RNA species.probableO26779
Probable exosome complex exonuclease 1 Probably involved in the 3'->5' degradation of a variety of RNA species.probableQ5JIR6
Probable exosome complex exonuclease 1 Probably involved in the 3'->5' degradation of a variety of RNA species.probableQ8TYC1

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NN6, chain B
Confidence level:very confident
Coverage over the Query: 4-231
View the alignment between query and template
View the model in PyMOL