Citrus Sinensis ID: 026676

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MNIKAAYDIEHVSSTSKIDHELWLLDEINPKAARFPCCLVWTPLPVVSWLAPFIGHVGICREDGVSLDFSGSNLVNVDEFAVGAVARYLQLDRKQCCFPPNLSGHTCKQGYQHSEFGTAMTWDDALQLSNRQFEHRTYNIFTCNSHSFVANCLNRLCYGGSMSWNMTNVAALILFKGHWVNSTSIIRSFLPFTVVACLGLLIVGWPFLIGLFSLSFLLLGWYLLGTYCVKGLLEC

cccccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHccEEEEEcccCEEEEcccccEEcccccccccEEEEEEcccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccCCccccHHHHHHHHHHcccccccccHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc

***************SKIDHELWLLDEINPKAARFPCCLVWTPLPVVSWLAPFIGHVGICREDGVSLDFSGSNLVNVDEFAVGAVARYLQLDRKQCCFPPNLSGHTCKQGYQHSEFGTAMTWDDALQLSNRQFEHRTYNIFTCNSHSFVANCLNRLCYGGSMSWNMTNVAALILFKGHWVNSTSIIRSFLPFTVVACLGLLIVGWPFLIGLFSLSFLLLGWYLLGTYCVKGLLEC

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein REVERSION-TO-ETHYLENE SENSITIVITY1	Acts at an early step in the ethylene signaling pathway. Positively regulates ERT1, leading to the negative regulation of ethylene responses.	probable	F4ITL6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DPZ, chain X
Confidence level:probable
Coverage over the Query: 121-155
View the alignment between query and template
View the model in PyMOL