BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026682
         (235 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q8BZ32|ASXL2_MOUSE Putative Polycomb group protein ASXL2 OS=Mus musculus GN=Asxl2 PE=2
           SV=1
          Length = 1370

 Score = 30.8 bits (68), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 21/45 (46%)

Query: 122 GQFNGVVASDKNVVSPRFRDVTGRPPPLDLTFAPDLAVKLEEIPV 166
           G       S+KN   P     T  P PLD+T +P     LE++PV
Sbjct: 801 GTVEPKAGSNKNAPKPSALAKTTAPAPLDMTSSPVTTASLEKLPV 845


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.318    0.135    0.424 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 95,789,499
Number of Sequences: 539616
Number of extensions: 4055496
Number of successful extensions: 7652
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 7650
Number of HSP's gapped (non-prelim): 3
length of query: 235
length of database: 191,569,459
effective HSP length: 114
effective length of query: 121
effective length of database: 130,053,235
effective search space: 15736441435
effective search space used: 15736441435
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)