Citrus Sinensis ID: 026700

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-----

MGSLPQVVEECFGLLKLYSDGSISRSPNISFDVPFINDNSILYKDLIFNENIDLRLRLYKPTSIVNSSTKLPIVFYFHGGGFCFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEHRLPAALEDACCALKWLQGQAIMHANVMDTWLGEVDFDRVFVLGYSSGGNLAHHLAVRFGPGSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLEMYDRNLRVKLYSHGLT

ccccccEEEEccccEEEcccccEEEccccccccccccccccEEEEEEEcccccEEEEEEcccccccccccccEEEEECccCEEEccccccccHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEccccHHHHHHHHHHHHccccccccccEEEEEEEEcccccccccccccccccccccccHHHHHHHHHHcccccccc

***LPQVVEECFGLLKLYSDGSISRSPNISFDVPFINDNSILYKDLIFNENIDLRLRLYKPTSIVNSSTKLPIVFYFHGGGFCFGSRTFPNNHNICVRLASILQAAVIEPDYRLGPEHRLPAALEDACCALKWLQGQAIMHANVMDTWLGEVDFDRVFVLGYSSGGNLAHHLAVRFGPGSVELAPVRVRGYVLMSPFFGGCERTRSEEERPIDGIWTLEMYDRNLRVKLYSH***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable carboxylesterase 15	Carboxylesterase acting on esters with varying acyl chain length.	probable	Q9FG13

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O7R, chain A
Confidence level:very confident
Coverage over the Query: 15-232
View the alignment between query and template
View the model in PyMOL