Query         026722
Match_columns 234
No_of_seqs    176 out of 1467
Neff          7.2 
Searched_HMMs 13730
Date          Mon Mar 25 20:32:55 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026722.a3m -d /work/01045/syshi/HHdatabase/scop70.hhm -o /work/01045/syshi/hhsearch_scop/026722hhsearch_scop -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1vf5c3 f.23.23.1 (C:250-286)   22.5      52  0.0038   17.8   3.4   16  146-161    18-33  (37)
  2 d1pv7a_ f.38.1.2 (A:) Lactose   19.6      20  0.0014   27.4   1.7    7   73-79     45-51  (417)
  3 d1fftb2 f.17.2.1 (B:27-117) Cy  17.9      19  0.0014   23.5   1.0   12  205-216    39-50  (91)
  4 d2axtt1 f.23.34.1 (T:1-30) Pho   9.3      80  0.0058   15.8   1.6   18  198-215    11-28  (30)
  5 d1q90a3 f.23.23.1 (A:248-292)    7.6      91  0.0067   17.5   1.6   14  146-159    17-30  (45)
  6 d1rzhh2 f.23.10.1 (H:11-35) Ph   6.2 1.3E+02  0.0096   14.6   1.5   10   50-59      4-13  (26)
  7 d1rkla_ f.23.30.1 (A:) Oligosa   5.4 1.3E+02  0.0096   15.6   1.3   20  192-211     8-27  (36)
  8 d1vi0a2 a.121.1.1 (A:78-194) H   4.2 4.3E+02   0.031   15.9   4.5   35  149-183    57-92  (117)
  9 d1rh5b_ f.23.28.1 (B:) Preprot   3.9 3.5E+02   0.026   15.6   2.7   20    7-28     36-55  (56)
 10 d2axtm1 f.23.35.1 (M:1-36) Pho   3.7 2.1E+02   0.015   15.1   1.3   15   70-84      3-17  (36)

No 1  
>d1vf5c3 f.23.23.1 (C:250-286) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Mastigocladus laminosus [TaxId: 83541]}
Probab=22.49  E-value=52  Score=17.83  Aligned_cols=16  Identities=25%  Similarity=0.393  Sum_probs=11.1

Q ss_pred             hhhhhHHhhCCCcccc
Q 026722          146 LSAMKTVVTTKSVEFM  161 (234)
Q Consensus       146 l~~i~~vi~tks~~~~  161 (234)
                      +.|+--|+|+|..|-+
T Consensus        18 laQi~lVlKKKQ~EkV   33 (37)
T d1vf5c3          18 LAQLMLILKKKQVEKV   33 (37)
T ss_dssp             HHHHHHHHHTGGGCTT
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            5677777777777654


No 2  
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]}
Probab=19.65  E-value=20  Score=27.39  Aligned_cols=7  Identities=43%  Similarity=0.653  Sum_probs=2.7

Q ss_pred             hHHHHHH
Q 026722           73 FGILVEA   79 (234)
Q Consensus        73 ~G~~l~~   79 (234)
                      +|.+.++
T Consensus        45 ~g~i~s~   51 (417)
T d1pv7a_          45 TGIIFAA   51 (417)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            3444333


No 3  
>d1fftb2 f.17.2.1 (B:27-117) Cytochrome O ubiquinol oxidase, subunit II {Escherichia coli [TaxId: 562]}
Probab=17.86  E-value=19  Score=23.51  Aligned_cols=12  Identities=17%  Similarity=0.216  Sum_probs=5.7

Q ss_pred             hheeecCCCCCc
Q 026722          205 LYAIYRNAKPSK  216 (234)
Q Consensus       205 l~~~y~~~~~~~  216 (234)
                      ..++||+++.++
T Consensus        39 ~~~ryR~~~~~~   50 (91)
T d1fftb2          39 FAWKYRASNKDA   50 (91)
T ss_dssp             TTTTTTTSTTTC
T ss_pred             hheeeeccCCcc
Confidence            335565554443


No 4  
>d2axtt1 f.23.34.1 (T:1-30) Photosystem II reaction center protein T, PsbT {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=9.33  E-value=80  Score=15.77  Aligned_cols=18  Identities=22%  Similarity=0.405  Sum_probs=11.3

Q ss_pred             HHHHHHHhheeecCCCCC
Q 026722          198 LGTAQLVLYAIYRNAKPS  215 (234)
Q Consensus       198 l~~~ql~l~~~y~~~~~~  215 (234)
                      .+++-+..+.+|-++.|+
T Consensus        11 ac~i~lfffaiffreppr   28 (30)
T d2axtt1          11 ACIIALFFFAIFFREPPR   28 (30)
T ss_dssp             HHHHHHHHHHHHTSCCCC
T ss_pred             HHHHHHHHHHHHhcCCCC
Confidence            455566667777666665


No 5  
>d1q90a3 f.23.23.1 (A:248-292) Cytochrome f subunit of the cytochrome b6f complex, transmembrane anchor {Chlamydomonas reinhardtii [TaxId: 3055]}
Probab=7.60  E-value=91  Score=17.48  Aligned_cols=14  Identities=29%  Similarity=0.382  Sum_probs=6.3

Q ss_pred             hhhhhHHhhCCCcc
Q 026722          146 LSAMKTVVTTKSVE  159 (234)
Q Consensus       146 l~~i~~vi~tks~~  159 (234)
                      +.|+--|+|+|..|
T Consensus        17 laQi~LVLKKKQfE   30 (45)
T d1q90a3          17 LTQVLLVLKKKQFE   30 (45)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            34444444544443


No 6  
>d1rzhh2 f.23.10.1 (H:11-35) Photosystem II reaction centre subunit H, transmembrane region {Rhodobacter sphaeroides [TaxId: 1063]}
Probab=6.17  E-value=1.3e+02  Score=14.59  Aligned_cols=10  Identities=0%  Similarity=0.467  Sum_probs=5.4

Q ss_pred             HHHHHHHHhc
Q 026722           50 NSSLWTYYGI   59 (234)
Q Consensus        50 n~~lW~~YG~   59 (234)
                      +..+|+.|++
T Consensus         4 slaiw~fw~f   13 (26)
T d1rzhh2           4 SLAIYSFWIF   13 (26)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHHH
Confidence            4455666554


No 7  
>d1rkla_ f.23.30.1 (A:) Oligosaccharyltransferase subunit ost4p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=5.39  E-value=1.3e+02  Score=15.64  Aligned_cols=20  Identities=25%  Similarity=0.476  Sum_probs=17.2

Q ss_pred             hhhHHHHHHHHHHhheeecC
Q 026722          192 NGTGFLLGTAQLVLYAIYRN  211 (234)
Q Consensus       192 N~~g~~l~~~ql~l~~~y~~  211 (234)
                      |.+.+.+|+.-+.+..+|..
T Consensus         8 n~~~i~fgi~mmtliviyh~   27 (36)
T d1rkla_           8 NSLAITFGIVMMTLIVIYHA   27 (36)
T ss_dssp             GHHHHHHHHHHHHHHHHHHH
T ss_pred             CcEEeehhHHHHHHHHHHhh
Confidence            88889999999999888863


No 8  
>d1vi0a2 a.121.1.1 (A:78-194) Hypothetical transcriptional regulator YsiA {Bacillus subtilis [TaxId: 1423]}
Probab=4.16  E-value=4.3e+02  Score=15.93  Aligned_cols=35  Identities=3%  Similarity=-0.040  Sum_probs=27.1

Q ss_pred             hhHHhhCCCcc-ccchHHHHHHHHhHHHHHHHhhhc
Q 026722          149 MKTVVTTKSVE-FMPFMLSFFFFLNGGIWAFYALLV  183 (234)
Q Consensus       149 i~~vi~tks~~-~~~~~~~~~~~~~~~~W~~YG~~~  183 (234)
                      +++-++.+... ++++......+++.+-|.+|-++.
T Consensus        57 i~~g~~~G~ir~d~d~~~~a~~i~g~i~~~~~~w~~   92 (117)
T d1vi0a2          57 LTEGIQSGEIKEGLDVRLARQMIFGTIDETVTTWVM   92 (117)
T ss_dssp             HHHHHHTTCBCTTCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHcCCcccCCCHHHHHHHHHHHHHHHHHHHHh
Confidence            56778888885 689988888888888888764444


No 9  
>d1rh5b_ f.23.28.1 (B:) Preprotein translocase SecE subunit {Archaeon Methanococcus jannaschii [TaxId: 2190]}
Probab=3.86  E-value=3.5e+02  Score=15.59  Aligned_cols=20  Identities=30%  Similarity=0.477  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHhhHHHHH
Q 026722            7 YVGVIGNIISVLMFLAPVRTFW   28 (234)
Q Consensus         7 ~~g~la~i~si~~~lSplp~i~   28 (234)
                      ++|.+|.+.-+.+.  |++.+.
T Consensus        36 i~G~IGf~I~li~~--~i~~ii   55 (56)
T d1rh5b_          36 LLGIIGYIIHVPAT--YIKGIL   55 (56)
T ss_dssp             HHHHHHHHHHHHHH--HHHHHH
T ss_pred             HHHHHHHHHHHHHH--Hhhhhc
Confidence            55667766665553  666553


No 10 
>d2axtm1 f.23.35.1 (M:1-36) Photosystem II reaction center protein M, PsbM {Thermosynechococcus elongatus [TaxId: 146786]}
Probab=3.70  E-value=2.1e+02  Score=15.07  Aligned_cols=15  Identities=33%  Similarity=0.747  Sum_probs=0.0

Q ss_pred             ehhhHHHHHHHhhhh
Q 026722           70 VNGFGILVEAVYVTL   84 (234)
Q Consensus        70 ~N~~G~~l~~~~~~v   84 (234)
                      +|..|++....++.+
T Consensus         3 vN~Lg~iAt~LFilv   17 (36)
T d2axtm1           3 VNQLGLIATALFVLV   17 (36)
T ss_dssp             CCTTHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHHH


Done!