BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026726
(234 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1RK8|C Chain C, Structure Of The Cytosolic Protein Pym Bound To The
Mago- Y14 Core Of The Exon Junction Complex
Length = 58
Score = 49.7 bits (117), Expect = 1e-06, Method: Compositional matrix adjust.
Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
Query: 18 LSKTLKEGE-RILAPTRRPDGTLRKPIRIRAGYVPQDEVAIYQSKGALLRKELTALQEA 75
+S L+ E + + T+RPDGT RK R++ GYVPQ+EV +Y+SKG K+ A ++A
Sbjct: 1 MSTYLQSSEGKFIPATKRPDGTWRKARRVKDGYVPQEEVPLYESKG----KQFVAQRQA 55
>pdb|3FKY|A Chain A, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|B Chain B, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|C Chain C, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|D Chain D, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|E Chain E, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|F Chain F, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|G Chain G, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|H Chain H, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|I Chain I, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|J Chain J, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|K Chain K, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|L Chain L, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|M Chain M, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|N Chain N, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|O Chain O, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|P Chain P, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|Q Chain Q, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|R Chain R, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|S Chain S, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
pdb|3FKY|T Chain T, Crystal Structure Of The Glutamine Synthetase
Gln1deltan18 From The Yeast Saccharomyces Cerevisiae
Length = 370
Score = 28.5 bits (62), Expect = 3.7, Method: Compositional matrix adjust.
Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 12/56 (21%)
Query: 44 RIRAGYVPQDEVAIYQSKGALLRKELTALQEAP------------PGYDPELDAKP 87
RI A YV D +SKG L+K +T++ + P PG+D ++ KP
Sbjct: 23 RIIAEYVWIDGTGNLRSKGRTLKKRITSIDQLPEWNFDGSSTNQAPGHDSDIYLKP 78
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.304 0.125 0.333
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,025,844
Number of Sequences: 62578
Number of extensions: 212575
Number of successful extensions: 353
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 351
Number of HSP's gapped (non-prelim): 7
length of query: 234
length of database: 14,973,337
effective HSP length: 96
effective length of query: 138
effective length of database: 8,965,849
effective search space: 1237287162
effective search space used: 1237287162
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 50 (23.9 bits)