BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026758
(233 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3I9W|A Chain A, Crystal Structure Of The E. Coli Histidine Kinase Sensor
Tors Sensor Domain
Length = 290
Score = 32.7 bits (73), Expect = 0.17, Method: Compositional matrix adjust.
Identities = 21/73 (28%), Positives = 39/73 (53%), Gaps = 10/73 (13%)
Query: 34 NEAAPQALKGDEMLKNIFLD--------VKKKFETALGVLRKEKITIAPEDPAAVSQYAN 85
NE AL+ +M+ N+ L+ ++K+ A+ +L++ +I I EDP +Q A
Sbjct: 174 NELRLSALRVQQMVMNLGLEQIQKNAPTLEKQLNNAVKILQRRQIRI--EDPGVRAQVAT 231
Query: 86 VMKTVREKADLFS 98
+ TV + +DL +
Sbjct: 232 TLTTVSQYSDLLA 244
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.130 0.337
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,626,368
Number of Sequences: 62578
Number of extensions: 213951
Number of successful extensions: 762
Number of sequences better than 100.0: 31
Number of HSP's better than 100.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 21
Number of HSP's that attempted gapping in prelim test: 745
Number of HSP's gapped (non-prelim): 34
length of query: 233
length of database: 14,973,337
effective HSP length: 96
effective length of query: 137
effective length of database: 8,965,849
effective search space: 1228321313
effective search space used: 1228321313
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)