BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026807
         (233 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3LYE|A Chain A, Crystal Structure Of Oxaloacetate Acetylhydrolase
 pdb|3M0J|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Inhibitor 3,3-Difluorooxalacetate
 pdb|3M0K|A Chain A, Structure Of Oxaloacetate Acetylhydrolase In Complex With
           The Product Oxalate
          Length = 307

 Score = 32.3 bits (72), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 5/69 (7%)

Query: 6   DALSAFQTALQYNPQSAEVSRKIKRVSQLAKDKKRAQEVENIRSNVDMVQHLDEFK---- 61
           D LSA +TA++   +S  ++      S+L +      ++ ++R N DM+ +LD F     
Sbjct: 34  DGLSA-RTAMELGFKSLYMTGAGTTASRLGQPDLAIAQLHDMRDNADMIANLDPFGPPLI 92

Query: 62  SEMSEKYGA 70
           ++M   YG 
Sbjct: 93  ADMDTGYGG 101


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.130    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,712,657
Number of Sequences: 62578
Number of extensions: 258672
Number of successful extensions: 661
Number of sequences better than 100.0: 16
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 14
Number of HSP's that attempted gapping in prelim test: 659
Number of HSP's gapped (non-prelim): 16
length of query: 233
length of database: 14,973,337
effective HSP length: 96
effective length of query: 137
effective length of database: 8,965,849
effective search space: 1228321313
effective search space used: 1228321313
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)