Query         026811
Match_columns 232
No_of_seqs    207 out of 557
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 13:03:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026811.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026811hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0 1.6E-70 3.6E-75  475.9   0.4  208    8-224     1-215 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.6 0.00024 5.2E-09   52.1   6.2   68  116-208     3-71  (84)
  3 smart00666 PB1 PB1 domain. Pho  97.3  0.0016 3.5E-08   47.7   7.7   65  117-207     4-69  (81)
  4 cd06398 PB1_Joka2 The PB1 doma  97.1  0.0021 4.6E-08   50.0   7.1   68  116-208     2-72  (91)
  5 cd06407 PB1_NLP A PB1 domain i  97.1  0.0023   5E-08   48.8   6.9   55  117-196     3-57  (82)
  6 cd05992 PB1 The PB1 domain is   97.0  0.0045 9.7E-08   45.0   7.3   65  117-207     3-69  (81)
  7 cd06396 PB1_NBR1 The PB1 domai  96.6  0.0088 1.9E-07   46.0   6.7   53  117-195     3-55  (81)
  8 cd06401 PB1_TFG The PB1 domain  96.3   0.025 5.5E-07   43.6   7.7   72  117-211     3-78  (81)
  9 cd06403 PB1_Par6 The PB1 domai  96.2   0.021 4.6E-07   44.0   6.9   72  117-212     3-76  (80)
 10 cd06402 PB1_p62 The PB1 domain  96.0   0.024 5.1E-07   44.1   6.4   60  115-197     1-65  (87)
 11 cd06409 PB1_MUG70 The MUG70 pr  95.7   0.022 4.8E-07   44.2   5.0   51  124-195     7-59  (86)
 12 cd06404 PB1_aPKC PB1 domain is  95.5   0.043 9.4E-07   42.5   6.0   56  117-197     3-58  (83)
 13 cd06397 PB1_UP1 Uncharacterize  95.1   0.081 1.8E-06   41.0   6.1   65  117-207     3-68  (82)
 14 cd06408 PB1_NoxR The PB1 domai  91.9     0.6 1.3E-05   36.4   6.1   55  115-197     3-57  (86)
 15 cd06399 PB1_P40 The PB1 domain  68.9     8.2 0.00018   30.6   4.0   37  130-192    22-58  (92)
 16 PF10411 DsbC_N:  Disulfide bon  54.5      11 0.00023   26.6   2.1   17  181-197    34-50  (57)
 17 cd06395 PB1_Map2k5 PB1 domain   52.6      28  0.0006   27.4   4.3   50  122-196     9-58  (91)
 18 PF09840 DUF2067:  Uncharacteri  41.7      14 0.00031   32.4   1.3   37  169-209    89-125 (190)
 19 COG0219 CspR Predicted rRNA me  40.2      14  0.0003   31.8   1.0   54  122-197    48-104 (155)
 20 PF12426 DUF3674:  RNA dependen  34.2      22 0.00048   24.3   1.1   14  142-155     7-21  (41)
 21 PRK13361 molybdenum cofactor b  32.2 1.3E+02  0.0029   27.6   6.2   77  120-214   188-266 (329)
 22 PF06463 Mob_synth_C:  Molybden  27.9 1.3E+02  0.0028   24.4   4.7   67  130-214    17-83  (128)
 23 COG3286 Uncharacterized protei  27.4      33 0.00071   30.8   1.3   38  169-210    92-129 (204)
 24 PF11576 DUF3236:  Protein of u  26.5      24 0.00051   30.4   0.2   13   12-24     97-109 (154)
 25 KOG3606 Cell polarity protein   25.9      82  0.0018   30.1   3.6   79  114-218    18-102 (358)
 26 KOG3938 RGS-GAIP interacting p  25.2 1.1E+02  0.0023   29.2   4.2   76  121-222    61-143 (334)
 27 cd00771 ThrRS_core Threonyl-tR  24.4      11 0.00025   34.3  -2.2   55  113-190   208-262 (298)
 28 PF09676 TraV:  Type IV conjuga  23.9      52  0.0011   25.8   1.7   19  179-197    92-110 (119)
 29 PF09582 AnfO_nitrog:  Iron onl  22.4      60  0.0013   28.7   2.0   49  176-227    17-83  (202)
 30 PF15390 DUF4613:  Domain of un  21.6      77  0.0017   33.0   2.7   58  114-190   597-658 (671)
 31 PF02013 CBM_10:  Cellulose or   21.1      27 0.00058   23.1  -0.4   12  181-192    16-27  (36)
 32 PF03589 Antiterm:  Antitermina  21.1      38 0.00081   26.6   0.4   29    7-49     17-45  (95)
 33 PF07929 PRiA4_ORF3:  Plasmid p  20.9 1.1E+02  0.0025   25.5   3.3   35  116-150     6-42  (179)
 34 PLN02622 iron superoxide dismu  20.5 1.9E+02  0.0041   26.6   4.9   53  139-217   142-194 (261)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=1.6e-70  Score=475.89  Aligned_cols=208  Identities=54%  Similarity=0.882  Sum_probs=6.0

Q ss_pred             CCccccccccCCCCCCCCCchhhhhhhcCCCCCCCCCCCCchhhhhhhhhccccccccc--ccccCCCCCCCCCCCCCCC
Q 026811            8 MDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCETAVIDLKLNLQSKESSV--DLNENFKNPPSNNKNHDKD   85 (232)
Q Consensus         8 lnl~~TELRLGLPG~~~~~~~~~~~~~~~~~~~~~~KRgfset~~~d~k~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~   85 (232)
                      ||||+|||||||||+++++..   .........+++||+|+++  ++............  ..................+
T Consensus         1 ln~~~TELrLGLPG~~~~~~~---~~~~~~~~~~~~kR~F~~a--id~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   75 (215)
T PF02309_consen    1 LNLKATELRLGLPGSESPDAS---SSSSSKKSSSGNKRGFSEA--IDSSSSNSQSSSSSSSDSSSSSSSSSTSSSSSDSS   75 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCchhhhhcccCCCCCCCCcc---cccccccccCcccccchhh--hhhcccccccccccccccCcccccccccccccccc
Confidence            799999999999999875411   1122334568899999998  66543100000000  0000000000000000122


Q ss_pred             CCCCCCCCCCcccCCCCccchhhhccc-----CCceeEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCC
Q 026811           86 PAKPSANKAQVVGWPPVRSYRKNAMAE-----TAAFVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQ  160 (232)
Q Consensus        86 ~~~p~~~k~qvVGWPPvrs~Rkn~~~~-----~~~~VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~  160 (232)
                      ...+|++++|+|||||||+||+|.+..     .++||||+|||+||||||||++|+||++|+.+|++||.+|+|++|+++
T Consensus        76 ~~~~p~~~~~~vgwpp~~s~r~n~~~~~~~~~~~~~vKV~mdG~~igRkVDL~~~~sY~~L~~~L~~MF~~~~i~~~~~~  155 (215)
T PF02309_consen   76 SSSPPASKAQVVGWPPVRSFRKNSLSEKQSSSSRSYVKVNMDGVPIGRKVDLSAYSSYEELSSALEKMFSCFSIEQCGSH  155 (215)
T ss_dssp             ----------BTTBS----S------------------------------------------------------------
T ss_pred             cCCCCcccccccCCCcccccccccccccccccCCceeEEEecCcccceecCHHHhhCHHHHHHHHHHhcCCCCccccccc
Confidence            334455789999999999999998863     579999999999999999999999999999999999999999988875


Q ss_pred             CcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCcChhHHhhccceeEEecCccccCCChhh
Q 026811          161 GMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEAIGLAPRA  224 (232)
Q Consensus       161 g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDvPWemFv~s~KRLrImk~sea~gl~~~~  224 (232)
                      +    .++..+.+++++++|+|||||+||||||||||||+|||++|||||||+.+|++||+||+
T Consensus       156 ~----~~~~~~~~~~~~~~~~l~Y~D~egd~mlvGD~PW~~F~~~vkRl~I~~~~e~~~~~~r~  215 (215)
T PF02309_consen  156 G----LNESGLLDLLNGSEYVLVYEDKEGDWMLVGDVPWEEFVKSVKRLRIMKSSEAKGLAPRA  215 (215)
T ss_dssp             ----------------------------------------------------------------
T ss_pred             c----ccchhhccccCCcceeEEEECCCCCEEEecCCCHHHHHHHhhccEEecHHHhcccCCCC
Confidence            4    46677888888899999999999999999999999999999999999999999999986


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.57  E-value=0.00024  Score=52.13  Aligned_cols=68  Identities=24%  Similarity=0.406  Sum_probs=55.3

Q ss_pred             eeEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec
Q 026811          116 FVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG  195 (232)
Q Consensus       116 ~VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG  195 (232)
                      -|||...|... |.+.+..--+|++|...+++.|...                        ...+.+.|.|.||||..+-
T Consensus         3 ~vK~~~~~~~~-~~~~~~~~~s~~~L~~~i~~~~~~~------------------------~~~~~l~Y~D~dgD~V~i~   57 (84)
T PF00564_consen    3 RVKVRYGGDIR-RIISLPSDVSFDDLRSKIREKFGLL------------------------DEDFQLKYKDEDGDLVTIS   57 (84)
T ss_dssp             EEEEEETTEEE-EEEEECSTSHHHHHHHHHHHHHTTS------------------------TSSEEEEEEETTSSEEEES
T ss_pred             EEEEEECCeeE-EEEEcCCCCCHHHHHHHHHHHhCCC------------------------CccEEEEeeCCCCCEEEeC
Confidence            48999999843 3588888889999999999999961                        3468999999999999887


Q ss_pred             C-cChhHHhhccce
Q 026811          196 D-VPWEMFVDSCKR  208 (232)
Q Consensus       196 D-vPWemFv~s~KR  208 (232)
                      + .=|.+.++.+++
T Consensus        58 sd~Dl~~a~~~~~~   71 (84)
T PF00564_consen   58 SDEDLQEAIEQAKE   71 (84)
T ss_dssp             SHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHh
Confidence            4 458888887753


No 3  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.29  E-value=0.0016  Score=47.70  Aligned_cols=65  Identities=23%  Similarity=0.397  Sum_probs=51.7

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecC
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  196 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGD  196 (232)
                      |||.-.|.  -|.+-+..--+|++|...+.+.|...                        ...+.|.|+|.||||..+.+
T Consensus         4 vK~~~~~~--~~~~~~~~~~s~~dL~~~i~~~~~~~------------------------~~~~~l~Y~Dedgd~v~l~s   57 (81)
T smart00666        4 VKLRYGGE--TRRLSVPRDISFEDLRSKVAKRFGLD------------------------NQSFTLKYQDEDGDLVSLTS   57 (81)
T ss_pred             EEEEECCE--EEEEEECCCCCHHHHHHHHHHHhCCC------------------------CCCeEEEEECCCCCEEEecC
Confidence            78887554  67788888999999999999999851                        23689999999999987654


Q ss_pred             -cChhHHhhccc
Q 026811          197 -VPWEMFVDSCK  207 (232)
Q Consensus       197 -vPWemFv~s~K  207 (232)
                       .=|.+.++.++
T Consensus        58 d~Dl~~a~~~~~   69 (81)
T smart00666       58 DEDLEEAIEEYD   69 (81)
T ss_pred             HHHHHHHHHHHH
Confidence             56777777665


No 4  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=97.11  E-value=0.0021  Score=50.00  Aligned_cols=68  Identities=24%  Similarity=0.262  Sum_probs=52.2

Q ss_pred             eeEEEecCcccceeeccC---CCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeE
Q 026811          116 FVKVCMDGAPYLRKVDLK---TYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWM  192 (232)
Q Consensus       116 ~VKV~MdG~p~gRKVDL~---~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwM  192 (232)
                      -|||.-+|.-+==++++.   .--+|++|...+.+.|...                       ...+|++.|.|.||||.
T Consensus         2 ~vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l~-----------------------~~~~~~l~Y~Dedgd~V   58 (91)
T cd06398           2 VVKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSLS-----------------------PDADLSLTYTDEDGDVV   58 (91)
T ss_pred             EEEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCCC-----------------------CCCcEEEEEECCCCCEE
Confidence            489999999433344443   4579999999999999851                       13589999999999999


Q ss_pred             EecCcChhHHhhccce
Q 026811          193 LVGDVPWEMFVDSCKR  208 (232)
Q Consensus       193 LVGDvPWemFv~s~KR  208 (232)
                      .+-..  +.|...+.+
T Consensus        59 ~l~~D--~DL~~a~~~   72 (91)
T cd06398          59 TLVDD--NDLTDAIQY   72 (91)
T ss_pred             EEccH--HHHHHHHHH
Confidence            98776  666666655


No 5  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=97.08  E-value=0.0023  Score=48.80  Aligned_cols=55  Identities=25%  Similarity=0.390  Sum_probs=44.9

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecC
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  196 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGD  196 (232)
                      |||+..|.  .+.+-|..--+|++|...+.++|..   .                    +.+.|.|-|.|.||||.++--
T Consensus         3 vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~---~--------------------~~~~f~LkY~Ddegd~v~lts   57 (82)
T cd06407           3 VKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKL---D--------------------DMSAFDLKYLDDDEEWVLLTC   57 (82)
T ss_pred             EEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCC---C--------------------CCCeeEEEEECCCCCeEEeec
Confidence            89999887  5566666667999999999999995   1                    135799999999999998743


No 6  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.96  E-value=0.0045  Score=45.02  Aligned_cols=65  Identities=23%  Similarity=0.402  Sum_probs=51.3

Q ss_pred             eEEEecCcccceeeccC-CCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec
Q 026811          117 VKVCMDGAPYLRKVDLK-TYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG  195 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~-~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG  195 (232)
                      |||.-.|.  -|.+=+. .--+|++|...|.+.|...                        ...+.+.|.|.||||..+.
T Consensus         3 vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~------------------------~~~~~l~y~D~e~d~v~l~   56 (81)
T cd05992           3 VKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLD------------------------AVSFKLKYPDEDGDLVTIS   56 (81)
T ss_pred             EEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCC------------------------CCcEEEEeeCCCCCEEEeC
Confidence            78888766  3445555 8889999999999999961                        1367999999999999988


Q ss_pred             C-cChhHHhhccc
Q 026811          196 D-VPWEMFVDSCK  207 (232)
Q Consensus       196 D-vPWemFv~s~K  207 (232)
                      + .=|++.++.++
T Consensus        57 sd~Dl~~a~~~~~   69 (81)
T cd05992          57 SDEDLEEAIEEAR   69 (81)
T ss_pred             CHHHHHHHHHHHh
Confidence            7 56777777665


No 7  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.59  E-value=0.0088  Score=46.03  Aligned_cols=53  Identities=19%  Similarity=0.235  Sum_probs=45.3

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG  195 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG  195 (232)
                      |||.-.|.-+-=+++-+..-+|++|...+.++|+.                        +  .|.+.|-|.||||.++-
T Consensus         3 vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l------------------------~--~f~lKYlDde~e~v~ls   55 (81)
T cd06396           3 LKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGL------------------------N--DIQIKYVDEENEEVSVN   55 (81)
T ss_pred             EEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCC------------------------C--cceeEEEcCCCCEEEEE
Confidence            78999998766677777788999999999999996                        1  46899999999998873


No 8  
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=96.31  E-value=0.025  Score=43.63  Aligned_cols=72  Identities=19%  Similarity=0.383  Sum_probs=48.5

Q ss_pred             eEEEecCcccceeeccCCC-CCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec
Q 026811          117 VKVCMDGAPYLRKVDLKTY-KSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG  195 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~-~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG  195 (232)
                      +|+.-.|. | |++=+..- -+|.+|...+++.|... .                    ....++.+.|.|.|||+.-+.
T Consensus         3 iK~~~g~D-i-R~~~~~~~~~t~~~L~~~v~~~F~~~-~--------------------~~~~~flIKYkD~dGDlVTIt   59 (81)
T cd06401           3 LKAQLGDD-I-RRIPIHNEDITYDELLLMMQRVFRGK-L--------------------GSSDDVLIKYKDEDGDLITIF   59 (81)
T ss_pred             EEEEeCCe-E-EEEeccCccccHHHHHHHHHHHhccc-c--------------------CCcccEEEEEECCCCCEEEec
Confidence            67777665 3 55444332 39999999999999951 1                    123478999999999999998


Q ss_pred             Cc---ChhHHhhccceeEE
Q 026811          196 DV---PWEMFVDSCKRMRI  211 (232)
Q Consensus       196 Dv---PWemFv~s~KRLrI  211 (232)
                      +-   -|..=+...+||+|
T Consensus        60 s~~dL~~A~~~~~~~~l~~   78 (81)
T cd06401          60 DSSDLSFAIQCSRILKLTL   78 (81)
T ss_pred             cHHHHHHHHhcCcceEEEE
Confidence            75   33333334445554


No 9  
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=96.25  E-value=0.021  Score=43.97  Aligned_cols=72  Identities=19%  Similarity=0.296  Sum_probs=51.6

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec-
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG-  195 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG-  195 (232)
                      ||..-|..=-==.+|.....+|+++++-|+.||..                        .+..|+|-|.|.+||.+-+- 
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l------------------------~~~~f~i~Y~D~~gDLLPInN   58 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHI------------------------PNVDFLIGYTDPHGDLLPINN   58 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCC------------------------CCCcEEEEEeCCCCCEecccC
Confidence            66666666211245555669999999999999996                        13478999999999999775 


Q ss_pred             CcChhHHhhccce-eEEe
Q 026811          196 DVPWEMFVDSCKR-MRIM  212 (232)
Q Consensus       196 DvPWemFv~s~KR-LrIm  212 (232)
                      |+-+..=++++++ |||.
T Consensus        59 DdNf~kAlssa~plLRl~   76 (80)
T cd06403          59 DDNFLKALSSANPLLRIF   76 (80)
T ss_pred             cHHHHHHHHcCCCceEEE
Confidence            4555555667775 5554


No 10 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.04  E-value=0.024  Score=44.15  Aligned_cols=60  Identities=25%  Similarity=0.433  Sum_probs=45.4

Q ss_pred             ceeEEEecC---ccccee--eccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCC
Q 026811          115 AFVKVCMDG---APYLRK--VDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDG  189 (232)
Q Consensus       115 ~~VKV~MdG---~p~gRK--VDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdG  189 (232)
                      +.||.+..|   .+==|+  ||=....+|++|...+.++|..                       +.+..|.+.|.|.||
T Consensus         1 ~~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~-----------------------l~~~~ftlky~DeeG   57 (87)
T cd06402           1 LTVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPS-----------------------LRGKNFQLFWKDEEG   57 (87)
T ss_pred             CeEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHccc-----------------------cCCCcEEEEEECCCC
Confidence            368888877   233344  4446677999999999999974                       124689999999999


Q ss_pred             CeEEecCc
Q 026811          190 DWMLVGDV  197 (232)
Q Consensus       190 DwMLVGDv  197 (232)
                      |..-+...
T Consensus        58 DlvtIssd   65 (87)
T cd06402          58 DLVAFSSD   65 (87)
T ss_pred             CEEeecCH
Confidence            99877654


No 11 
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=95.71  E-value=0.022  Score=44.22  Aligned_cols=51  Identities=22%  Similarity=0.367  Sum_probs=38.5

Q ss_pred             cccceeeccC--CCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEec
Q 026811          124 APYLRKVDLK--TYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVG  195 (232)
Q Consensus       124 ~p~gRKVDL~--~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVG  195 (232)
                      +|-||.+=++  ...|+.+|..++.+=|+.-.                     .....|.|.|.|.||||.+.-
T Consensus         7 ~~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d~---------------------~~~~~~~L~YlDDEgD~VllT   59 (86)
T cd06409           7 DPKGRVHRFRLRPSESLEELRTLISQRLGDDD---------------------FETHLYALSYVDDEGDIVLIT   59 (86)
T ss_pred             CCCCCEEEEEecCCCCHHHHHHHHHHHhCCcc---------------------ccCCcccEEEEcCCCCEEEEe
Confidence            4567765554  37899999999999888510                     013478999999999999874


No 12 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=95.54  E-value=0.043  Score=42.53  Aligned_cols=56  Identities=21%  Similarity=0.325  Sum_probs=45.4

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecC
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  196 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGD  196 (232)
                      ||++-.|.-+--.+|.  .-+|++|.+.+.+||..                       ..+..|++.|.|.|||---+..
T Consensus         3 ~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~-----------------------~~~q~ft~kw~DEEGDp~tiSS   57 (83)
T cd06404           3 VKAAYNGDIMITSIDP--SISLEELCNEVRDMCRF-----------------------HNDQPFTLKWIDEEGDPCTISS   57 (83)
T ss_pred             EEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCC-----------------------CCCCcEEEEEECCCCCceeecC
Confidence            7899999866656666  67899999999999995                       1245799999999999877655


Q ss_pred             c
Q 026811          197 V  197 (232)
Q Consensus       197 v  197 (232)
                      .
T Consensus        58 ~   58 (83)
T cd06404          58 Q   58 (83)
T ss_pred             H
Confidence            3


No 13 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=95.06  E-value=0.081  Score=40.97  Aligned_cols=65  Identities=17%  Similarity=0.247  Sum_probs=49.6

Q ss_pred             eEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecC
Q 026811          117 VKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  196 (232)
Q Consensus       117 VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGD  196 (232)
                      -||.-+|.  .|++--..-=+|..|.+.|+.+|....                       . .+.+||.|.|||-.-+-|
T Consensus         3 fKv~~~g~--~RRf~~~~~pt~~~L~~kl~~Lf~lp~-----------------------~-~~~vtYiDeD~D~ITlss   56 (82)
T cd06397           3 FKSSFLGD--TRRIVFPDIPTWEALASKLENLYNLPE-----------------------I-KVGVTYIDNDNDEITLSS   56 (82)
T ss_pred             EEEEeCCc--eEEEecCCCccHHHHHHHHHHHhCCCh-----------------------h-HeEEEEEcCCCCEEEecc
Confidence            48888887  899988889999999999999999621                       1 278999999999875544


Q ss_pred             -cChhHHhhccc
Q 026811          197 -VPWEMFVDSCK  207 (232)
Q Consensus       197 -vPWemFv~s~K  207 (232)
                       .=-+.|..-..
T Consensus        57 d~eL~d~~~~~~   68 (82)
T cd06397          57 NKELQDFYRLSH   68 (82)
T ss_pred             hHHHHHHHHhcc
Confidence             34445544333


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=91.86  E-value=0.6  Score=36.38  Aligned_cols=55  Identities=20%  Similarity=0.305  Sum_probs=45.3

Q ss_pred             ceeEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEe
Q 026811          115 AFVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLV  194 (232)
Q Consensus       115 ~~VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLV  194 (232)
                      .=|||+-.|.  .|-|-+..--+|++|...+.++|+.                         ...+.+-|.|. ||..-+
T Consensus         3 ikVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~-------------------------~~~~~iKykDE-GD~iti   54 (86)
T cd06408           3 IRVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGF-------------------------KRRLKIKMKDD-GDMITM   54 (86)
T ss_pred             EEEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCC-------------------------CCceEEEEEcC-CCCccc
Confidence            3489998888  6777777777899999999999995                         12678999999 999888


Q ss_pred             cCc
Q 026811          195 GDV  197 (232)
Q Consensus       195 GDv  197 (232)
                      ++-
T Consensus        55 ~sq   57 (86)
T cd06408          55 GDQ   57 (86)
T ss_pred             cCH
Confidence            764


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=68.91  E-value=8.2  Score=30.57  Aligned_cols=37  Identities=24%  Similarity=0.397  Sum_probs=30.1

Q ss_pred             eccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeE
Q 026811          130 VDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWM  192 (232)
Q Consensus       130 VDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwM  192 (232)
                      =||+..-+|.+|..-..+-|...                          +-+|-|.|.|||..
T Consensus        22 e~l~~~P~~kdLl~lmr~~f~~~--------------------------dIaLNYrD~EGDLI   58 (92)
T cd06399          22 EDLSSTPLLKDLLELTRREFQRE--------------------------DIALNYRDAEGDLI   58 (92)
T ss_pred             cccccCccHHHHHHHHHHHhchh--------------------------heeeeeecCCCCEE
Confidence            37888889999999888888852                          23678999999974


No 16 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=54.54  E-value=11  Score=26.61  Aligned_cols=17  Identities=29%  Similarity=0.649  Sum_probs=14.6

Q ss_pred             eeEEEcCCCCeEEecCc
Q 026811          181 VPTYEDKDGDWMLVGDV  197 (232)
Q Consensus       181 vltYeDkdGDwMLVGDv  197 (232)
                      -+.|.|.||+++++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            47899999999999985


No 17 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=52.57  E-value=28  Score=27.42  Aligned_cols=50  Identities=22%  Similarity=0.340  Sum_probs=35.3

Q ss_pred             cCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecC
Q 026811          122 DGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGD  196 (232)
Q Consensus       122 dG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGD  196 (232)
                      +|..+--.||...+=++.+++.++.+..-.-|.                         -..-|||.|||..-|--
T Consensus         9 ~gg~vDw~V~~~~~L~F~DvL~~I~~vlp~aT~-------------------------tAFeYEDE~gDRITVRS   58 (91)
T cd06395           9 NGGAVDWTVQSGPQLLFRDVLDVIGQVLPEATT-------------------------TAFEYEDEDGDRITVRS   58 (91)
T ss_pred             CCCcccccccCcccccHHHHHHHHHHhcccccc-------------------------cceeeccccCCeeEecc
Confidence            345566677777778889998888876553221                         13579999999988743


No 18 
>PF09840 DUF2067:  Uncharacterized protein conserved in archaea (DUF2067);  InterPro: IPR019202  This family of archaeal proteins, have no known function. 
Probab=41.66  E-value=14  Score=32.38  Aligned_cols=37  Identities=27%  Similarity=0.488  Sum_probs=30.9

Q ss_pred             hhhhhccCCCCeeeEEEcCCCCeEEecCcChhHHhhcccee
Q 026811          169 SKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRM  209 (232)
Q Consensus       169 ~~l~d~~~~se~vltYeDkdGDwMLVGDvPWemFv~s~KRL  209 (232)
                      .-|.|.++-.+|..-|.+.    -|..|.||+.+++.++||
T Consensus        89 d~L~~~L~~~G~~ae~~~~----~i~T~a~~eev~~l~~~L  125 (190)
T PF09840_consen   89 DLLVDALKLLGYKAEYRED----VIKTDAPLEEVVELAERL  125 (190)
T ss_pred             HHHHHHHHhCCCeeEEeCC----eEEecCCHHHHHHHHHHH
Confidence            3566777778899998654    889999999999999996


No 19 
>COG0219 CspR Predicted rRNA methylase (SpoU class) [Translation, ribosomal structure and biogenesis]
Probab=40.16  E-value=14  Score=31.84  Aligned_cols=54  Identities=26%  Similarity=0.452  Sum_probs=38.7

Q ss_pred             cCcccceeeccCCCCCHHHHHHHH---HHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCc
Q 026811          122 DGAPYLRKVDLKTYKSYQELSDAL---AKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDV  197 (232)
Q Consensus       122 dG~p~gRKVDL~~~~sY~eL~~aL---e~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDv  197 (232)
                      -|-.|.-+++|..|++|++...+.   .++|...|.+.                     .-|. -+....|||+|-|-.
T Consensus        48 AGlDY~~~~~l~~h~s~e~fl~~~~~~~rl~~~tt~~~---------------------~~~~-~~~f~~~d~llFG~E  104 (155)
T COG0219          48 AGLDYHEKASLTEHDSLEAFLEAEPIGGRLFALTTKGT---------------------TTYT-DVSFQKGDYLLFGPE  104 (155)
T ss_pred             cccchHhhcceEEeCCHHHHHhhccCCceEEEEEeccc---------------------cccc-cccCCCCCEEEECCC
Confidence            477799999999999999999998   46777544331                     0111 134456999999975


No 20 
>PF12426 DUF3674:  RNA dependent RNA polymerase;  InterPro: IPR024378 This domain is found in the RNA-directed RNA polymerase. It is located towards the N terminus and is approximately 40 amino acids in length. There is a conserved MFNLKF sequence motif. There are two completely conserved residues (E and P) that may be functionally important.
Probab=34.19  E-value=22  Score=24.33  Aligned_cols=14  Identities=43%  Similarity=0.766  Sum_probs=10.8

Q ss_pred             HHHHHHhhcc-ccCC
Q 026811          142 SDALAKMFSS-FTMG  155 (232)
Q Consensus       142 ~~aLe~MF~~-~~~~  155 (232)
                      ..+||.||+. |.|+
T Consensus         7 R~aLEAMFNLKFhi~   21 (41)
T PF12426_consen    7 RSALEAMFNLKFHIG   21 (41)
T ss_pred             HHHHHHHhceeeeeC
Confidence            6899999994 5554


No 21 
>PRK13361 molybdenum cofactor biosynthesis protein A; Provisional
Probab=32.20  E-value=1.3e+02  Score=27.57  Aligned_cols=77  Identities=12%  Similarity=0.128  Sum_probs=42.3

Q ss_pred             EecCcccceeec--cCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCc
Q 026811          120 CMDGAPYLRKVD--LKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDV  197 (232)
Q Consensus       120 ~MdG~p~gRKVD--L~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDv  197 (232)
                      +.+=.|+|+--+  -..+=+.+++...|++.|....+.. .                .++.-....+.|..|-.=++.-+
T Consensus       188 ~ie~mP~g~~~~~~~~~~~~~~e~~~~l~~~~~~~~~~~-~----------------~~~~~~~~~~~~~~~~ig~I~~~  250 (329)
T PRK13361        188 FIEEMPLGEIDERRRARHCSSDEVRAIIETRYPLTPSNK-R----------------TGGPARYYTMADSPIHIGFISPH  250 (329)
T ss_pred             EEecccCCCccchhhccCcCHHHHHHHHHHhCCcccCCC-C----------------CCCCCeEEEECCCCeEEEEEcCC
Confidence            556677776222  3456678888888888776422210 0                01111111122333444444444


Q ss_pred             ChhHHhhccceeEEecC
Q 026811          198 PWEMFVDSCKRMRIMKG  214 (232)
Q Consensus       198 PWemFv~s~KRLrImk~  214 (232)
                      -.. ||.+|.||||-..
T Consensus       251 s~~-fC~~Cnr~rlt~~  266 (329)
T PRK13361        251 SHN-FCHECNRVRVTAE  266 (329)
T ss_pred             Ccc-ccccCCeEEEccC
Confidence            444 9999999999654


No 22 
>PF06463 Mob_synth_C:  Molybdenum Cofactor Synthesis C;  InterPro: IPR010505 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cis-dithiolene moiety to molybdopterin (MPT). MoCF is ubiquitous in nature, and the pathway for MoCF biosynthesis is conserved in all three domains of life. MoCF-containing enzymes function as oxidoreductases in carbon, nitrogen, and sulphur metabolism [, ].  In Escherichia coli, biosynthesis of MoCF is a three stage process. It begins with the MoaA and MoaC conversion of GTP to the meta-stable pterin intermediate precursor Z. The second stage involves MPT synthase (MoaD and MoaE), which converts precursor Z to MPT; MoeB is involved in the recycling of MPT synthase. The final step in MoCF synthesis is the attachment of mononuclear Mo to MPT, a process that requires MoeA and which is enhanced by MogA in an Mg2 ATP-dependent manner []. MoCF is the active co-factor in eukaryotic and some prokaryotic molybdo-enzymes, but the majority of bacterial enzymes requiring MoCF, need a modification of MTP for it to be active; MobA is involved in the attachment of a nucleotide monophosphate to MPT resulting in the MGD co-factor, the active co-factor for most prokaryotic molybdo-enzymes. Bacterial two-hybrid studies have revealed the close interactions between MoeA, MogA, and MobA in the synthesis of MoCF []. Moreover the close functional association of MoeA and MogA in the synthesis of MoCF is supported by fact that the known eukaryotic homologues to MoeA and MogA exist as fusion proteins: CNX1 (Q39054 from SWISSPROT) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) []. This entry represents MoaA, which belongs to a family of enzymes involved in the synthesis of metallo-cofactors (IPR000385 from INTERPRO). Each subunit of the MoaA dimer is comprised of an N-terminal SAM domain (IPR007197 from INTERPRO) that contains the [4Fe-4S] cluster typical for this family of enzymes, as well as an additional [4Fe-4S] cluster in the C-terminal domain that is unique to MoaA proteins []. The unique Fe site of the C-terminal [4Fe-4S] cluster is thought to be involved in the binding and activation of 5'-GTP. Mutations in the human MoCF biosynthesis proteins MOCS1, MOCS2 or GEPH cause MoCF Deficiency type A (MOCOD), causing the loss of activity of MoCF-containing enzymes, resulting in neurological abnormalities and death [].; GO: 0051539 4 iron, 4 sulfur cluster binding, 0006777 Mo-molybdopterin cofactor biosynthetic process, 0019008 molybdopterin synthase complex; PDB: 2FB2_A 2FB3_A 1TV8_B 1TV7_A.
Probab=27.94  E-value=1.3e+02  Score=24.36  Aligned_cols=67  Identities=16%  Similarity=0.251  Sum_probs=28.9

Q ss_pred             eccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCcChhHHhhcccee
Q 026811          130 VDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRM  209 (232)
Q Consensus       130 VDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDvPWemFv~s~KRL  209 (232)
                      +--..|-+++++...|++-|.......   .            .  ++.-......+..|..=++.-+- +.||.+|.||
T Consensus        17 ~~~~~~~~~~ei~~~l~~~~~~~~~~~---~------------~--~~pa~~y~~~g~~g~vG~I~~~s-~~FC~~CNRi   78 (128)
T PF06463_consen   17 WFEEEFVPAQEILERLEERYELLPSEK---R------------P--NGPARYYRIPGGKGRVGFISPVS-NPFCSSCNRI   78 (128)
T ss_dssp             B-TTTB--HHHHHHHHHHHS-EEEE-----S------------S--T-SSEEEEETTT--EEEEE-TTT-S--GGG--EE
T ss_pred             chhhcCcCHHHHHHHHHHhCCcccccc---c------------c--CCcceEEEECCCCcEEEEEeCCC-CCCCCcCCEE
Confidence            334678889999999999888632210   0            0  12111122233333333333222 2499999999


Q ss_pred             EEecC
Q 026811          210 RIMKG  214 (232)
Q Consensus       210 rImk~  214 (232)
                      ||-..
T Consensus        79 RlTsd   83 (128)
T PF06463_consen   79 RLTSD   83 (128)
T ss_dssp             EE-TT
T ss_pred             EEccC
Confidence            99553


No 23 
>COG3286 Uncharacterized protein conserved in archaea [Function unknown]
Probab=27.42  E-value=33  Score=30.79  Aligned_cols=38  Identities=24%  Similarity=0.426  Sum_probs=30.7

Q ss_pred             hhhhhccCCCCeeeEEEcCCCCeEEecCcChhHHhhccceeE
Q 026811          169 SKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMR  210 (232)
Q Consensus       169 ~~l~d~~~~se~vltYeDkdGDwMLVGDvPWemFv~s~KRLr  210 (232)
                      .-|.|.+..-+|.+-|.   ||| |=-+.||+.|++.+++|-
T Consensus        92 ~vl~daLk~~GyrVevr---~~~-l~T~ap~~ev~E~vreLs  129 (204)
T COG3286          92 DVLIDALKLLGYRVEVR---GGE-LKTNAPWSEVVELVRELS  129 (204)
T ss_pred             HHHHHHHHhCCceEEee---Cce-eecCCCHHHHHHHHHHHH
Confidence            34667777789999886   455 889999999999999863


No 24 
>PF11576 DUF3236:  Protein of unknown function (DUF3236);  InterPro: IPR012019  This family of proteins with unknown function appears to be restricted to Methanobacteria. ; PDB: 3BRC_B.
Probab=26.53  E-value=24  Score=30.36  Aligned_cols=13  Identities=38%  Similarity=0.672  Sum_probs=7.8

Q ss_pred             ccccccCCCCCCC
Q 026811           12 ETELCLGLPGGGN   24 (232)
Q Consensus        12 ~TELRLGLPG~~~   24 (232)
                      ..-=|||.||+.+
T Consensus        97 IARGRLGvPGSGS  109 (154)
T PF11576_consen   97 IARGRLGVPGSGS  109 (154)
T ss_dssp             EEEEE-SSTTS-E
T ss_pred             EEcccccCCCCcc
Confidence            3344999999853


No 25 
>KOG3606 consensus Cell polarity protein PAR6 [Signal transduction mechanisms]
Probab=25.90  E-value=82  Score=30.06  Aligned_cols=79  Identities=24%  Similarity=0.342  Sum_probs=53.2

Q ss_pred             CceeEEEecCcccceeecc--CCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCe
Q 026811          114 AAFVKVCMDGAPYLRKVDL--KTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDW  191 (232)
Q Consensus       114 ~~~VKV~MdG~p~gRKVDL--~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDw  191 (232)
                      ..-||-..|-.  =|..-|  ..-.+|++++.-|++.-.+                        .+.++.|-|.|.-||.
T Consensus        18 ~veVKSKFdaE--fRRfsl~r~~~~~f~~F~~Lv~~~H~i------------------------~nvdvllgY~d~hgDL   71 (358)
T KOG3606|consen   18 TVEVKSKFDAE--FRRFSLPRHSASSFDEFYSLVEHLHHI------------------------PNVDVLLGYADTHGDL   71 (358)
T ss_pred             eEEeeccccch--hheecccccCcccHHHHHHHHHHHhcC------------------------CCceEEEEEecCCCce
Confidence            34455444443  344444  3446899999988888775                        2347889999999999


Q ss_pred             EEec-CcChhHHhhccc---eeEEecCcccc
Q 026811          192 MLVG-DVPWEMFVDSCK---RMRIMKGSEAI  218 (232)
Q Consensus       192 MLVG-DvPWemFv~s~K---RLrImk~sea~  218 (232)
                      +-+- |.-+.--+++++   ||-|-|..||.
T Consensus        72 LPinNDDn~~ka~~sa~PlLR~~iQkr~ea~  102 (358)
T KOG3606|consen   72 LPINNDDNLHKALSSARPLLRLLIQKREEAD  102 (358)
T ss_pred             ecccCchhHHHHhhccCchhhhhhhhhhhhh
Confidence            8664 555666666776   56677776664


No 26 
>KOG3938 consensus RGS-GAIP interacting protein GIPC, contains PDZ domain [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=25.18  E-value=1.1e+02  Score=29.15  Aligned_cols=76  Identities=25%  Similarity=0.342  Sum_probs=53.3

Q ss_pred             ecCcccceeeccCCCCCHHHHHHHHHHhhccccC--CCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCcC
Q 026811          121 MDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTM--GNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVP  198 (232)
Q Consensus       121 MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~--~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDvP  198 (232)
                      -+|.|.||   +..|++-+||++.+..-|.+...  --|.                +|  .|.     -|=+.||-|-.-
T Consensus        61 AHGSptg~---Ie~fsnv~ELY~kIAe~F~Is~~dIlfcT----------------lN--shK-----vDM~~llgGqig  114 (334)
T KOG3938|consen   61 AHGSPTGR---IEGFSNVRELYQKIAEAFDISPDDILFCT----------------LN--SHK-----VDMKRLLGGQIG  114 (334)
T ss_pred             ccCCccce---ecccccHHHHHHHHHHHhcCCccceEEEe----------------cC--CCc-----ccHHHHhcCccC
Confidence            47999998   56799999999999999986221  0010                01  011     234457888888


Q ss_pred             hhHHhh-----ccceeEEecCccccCCCh
Q 026811          199 WEMFVD-----SCKRMRIMKGSEAIGLAP  222 (232)
Q Consensus       199 WemFv~-----s~KRLrImk~sea~gl~~  222 (232)
                      .+.|+=     -.|-++|+|..++.||..
T Consensus       115 leDfiFAHvkGq~kEv~v~KsedalGlTI  143 (334)
T KOG3938|consen  115 LEDFIFAHVKGQAKEVEVVKSEDALGLTI  143 (334)
T ss_pred             hhhhhhhhhcCcceeEEEEecccccceEE
Confidence            888774     566799999999998763


No 27 
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain.
Probab=24.41  E-value=11  Score=34.27  Aligned_cols=55  Identities=22%  Similarity=0.309  Sum_probs=37.4

Q ss_pred             CCceeEEEecCcccceeeccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCC
Q 026811          113 TAAFVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGD  190 (232)
Q Consensus       113 ~~~~VKV~MdG~p~gRKVDL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGD  190 (232)
                      +-.|...-=||+-||-|||..+.++       |.+-+.|-|+.                .|.....-|-|+|.|+||.
T Consensus       208 ~~~~~~~~g~~afygpkid~~~~d~-------~gr~~q~~t~q----------------ld~~~~~~f~l~y~~~~~~  262 (298)
T cd00771         208 GLPYEINEGEGAFYGPKIDFHVKDA-------LGREWQCSTIQ----------------LDFNLPERFDLTYIGEDGE  262 (298)
T ss_pred             CCCceECCCCcccccceEEEEEEeC-------CCCeeecceeE----------------eeccChhhcCCEEEccCCC
Confidence            4567777788999999999988764       33444443321                1222345788999999986


No 28 
>PF09676 TraV:  Type IV conjugative transfer system lipoprotein (TraV);  InterPro: IPR014118 This entry represents TraV, a component of a conjugative type IV secretion system. TraV is an outer membrane lipoprotein that is believed to interact with the secretin TraK [, , ]. This protein contains three conserved cysteines in the N-terminal half.
Probab=23.93  E-value=52  Score=25.79  Aligned_cols=19  Identities=37%  Similarity=0.548  Sum_probs=16.2

Q ss_pred             CeeeEEEcCCCCeEEecCc
Q 026811          179 DYVPTYEDKDGDWMLVGDV  197 (232)
Q Consensus       179 e~vltYeDkdGDwMLVGDv  197 (232)
                      =|+.-|+|.+||+..-|.|
T Consensus        92 iwiaP~~D~~g~l~~~~~V  110 (119)
T PF09676_consen   92 IWIAPWEDADGDLHDPGYV  110 (119)
T ss_pred             EEEeeeECCCCCEeccceE
Confidence            4788999999999887766


No 29 
>PF09582 AnfO_nitrog:  Iron only nitrogenase protein AnfO (AnfO_nitrog);  InterPro: IPR014287 Proteins in this entry include Anf1 from Rhodobacter capsulatus (Rhodopseudomonas capsulata) and AnfO from Azotobacter vinelandii. They are found exclusively in species which contain the iron-only nitrogenase, and are encoded immediately downstream of the structural genes for the nitrogenase enzyme in these species. 
Probab=22.41  E-value=60  Score=28.74  Aligned_cols=49  Identities=29%  Similarity=0.766  Sum_probs=36.4

Q ss_pred             CCCCeeeEEEcCCCCeEEecCcChhH------------------HhhccceeEEecCccccCCChhhhhh
Q 026811          176 NSSDYVPTYEDKDGDWMLVGDVPWEM------------------FVDSCKRMRIMKGSEAIGLAPRAMEK  227 (232)
Q Consensus       176 ~~se~vltYeDkdGDwMLVGDvPWem------------------Fv~s~KRLrImk~sea~gl~~~~~~~  227 (232)
                      ...+++.+|+..+|+|-++.+.|.++                  |+..|   ||.-.+++.|+.--..++
T Consensus        17 ~e~G~v~vy~~~~g~W~~~~e~~f~~~~~~~l~~iR~~~~~li~~L~dC---kifV~~~v~Gi~y~~Le~   83 (202)
T PF09582_consen   17 YEPGFVRVYEKDDGKWKVIREIPFELCDAKGLAEIRQKISELIEFLGDC---KIFVAKSVSGIPYSLLEK   83 (202)
T ss_pred             CCCcEEEEEECCCCceEEeEEEEeccCCCCCHHHHHHHHHHHHHHhCCc---EEEEEccccCccHHHHHH
Confidence            46789999999999999999999982                  44444   455666777776554443


No 30 
>PF15390 DUF4613:  Domain of unknown function (DUF4613)
Probab=21.56  E-value=77  Score=32.99  Aligned_cols=58  Identities=14%  Similarity=0.235  Sum_probs=36.1

Q ss_pred             CceeEEEecCcccceee----ccCCCCCHHHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCC
Q 026811          114 AAFVKVCMDGAPYLRKV----DLKTYKSYQELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDG  189 (232)
Q Consensus       114 ~~~VKV~MdG~p~gRKV----DL~~~~sY~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdG  189 (232)
                      ..||-|.-+-.-+.-+|    ..-..+|-=. +.++++||+..                  |.+++.++.|++.--|+||
T Consensus       597 ppyVhItyQk~~~~~~vvekRavLLC~GkLr-Ls~VQq~FgLs------------------lVEM~h~s~WIlLsADseG  657 (671)
T PF15390_consen  597 PPYVHITYQKPYSVGPVVEKRAVLLCDGKLR-LSTVQQTFGLS------------------LVEMLHGSHWILLSADSEG  657 (671)
T ss_pred             CCeEEEEEecccCCCCcceeeeEEEeCCeec-HHHHHHHhCcc------------------hhhhhhCCeEEEEecCCCC
Confidence            45777765433222222    1222233323 46899999973                  3466789999999999998


Q ss_pred             C
Q 026811          190 D  190 (232)
Q Consensus       190 D  190 (232)
                      =
T Consensus       658 F  658 (671)
T PF15390_consen  658 F  658 (671)
T ss_pred             e
Confidence            4


No 31 
>PF02013 CBM_10:  Cellulose or protein binding domain;  InterPro: IPR002883 This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria. The recycling of photosynthetically fixed carbon in plant cell walls is a key microbial process. Enzyme systems that attack the plant cell wall contain noncatalytic carbohydrate-binding modules that mediate attachment to this composite structure and play a pivotal role in maximizing the hydrolytic process. In anaerobes, the degradation is carried out by a high molecular weight, multifunctional complex termed the cellulosome. This consists of a number of independent enzyme components, each of which contains a conserved 40-residue dockerin domain, which functions to bind the enzyme to a cohesin domain within the scaffoldin protein [, ].  In anaerobic bacteria that degrade plant cell walls, exemplified by Clostridium thermocellum, the dockerin domains of the catalytic polypeptides can bind equally well to any cohesin from the same organism. More recently, anaerobic fungi, typified by Piromyces equi, have been suggested to also synthesise a cellulosome complex, although the dockerin sequences of the bacterial and fungal enzymes are completely different []. For example, the fungal enzymes contain one, two or three copies of the dockerin sequence in tandem within the catalytic polypeptide. In contrast, all the C. thermocellum cellulosome catalytic components contain a single dockerin domain. The anaerobic bacterial dockerins are homologous to EF hands (calcium-binding motifs) and require calcium for activity whereas the fungal dockerin does not require calcium. Finally, the interaction between cohesin and dockerin appears to be species specific in bacteria, there is almost no species specificity of binding within fungal species and no identified sites that distinguish different species.  The structure of dockerin from P. equi contains two helical stretches and four short beta-strands which form an antiparallel sheet structure adjacent to an additional short twisted parallel strand. The N- and C-termini are adjacent to each other.  Aerobic bacteria contain related regions, however these appear to function as cellulose/carbohydrate binding domains.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2J4M_A 2J4N_A 1E8R_A 1QLD_A 1E8P_A 1E8Q_A.
Probab=21.09  E-value=27  Score=23.12  Aligned_cols=12  Identities=42%  Similarity=0.869  Sum_probs=8.9

Q ss_pred             eeEEEcCCCCeE
Q 026811          181 VPTYEDKDGDWM  192 (232)
Q Consensus       181 vltYeDkdGDwM  192 (232)
                      .+.|.|.+|+|=
T Consensus        16 ~v~y~d~~g~WG   27 (36)
T PF02013_consen   16 EVVYTDDDGGWG   27 (36)
T ss_dssp             --SEEETTEEEE
T ss_pred             ceEEcCCCCCEe
Confidence            578999999983


No 32 
>PF03589 Antiterm:  Antitermination protein;  InterPro: IPR003222 This entry consists of antitermination proteins found in bacteriophages, such as protein Q from phage lambda, and some bacterial homologues. Protein Q positively regulates expression of the phage late gene operon by binding to the bacterial host RNA polymerase (RNAP) and modifying it. The modified RNAP transcribes through termination sites that otherwise prevent expression of the regulated genes [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent
Probab=21.05  E-value=38  Score=26.55  Aligned_cols=29  Identities=21%  Similarity=0.428  Sum_probs=22.3

Q ss_pred             CCCccccccccCCCCCCCCCchhhhhhhcCCCCCCCCCCCCch
Q 026811            7 KMDFKETELCLGLPGGGNNKKDEAAALELTPTPKASNKRGFCE   49 (232)
Q Consensus         7 ~lnl~~TELRLGLPG~~~~~~~~~~~~~~~~~~~~~~KRgfse   49 (232)
                      .|++++|++++|+|=-..              -..++||||+.
T Consensus        17 al~~~~s~~~~G~pvfk~--------------c~rcgg~G~sr   45 (95)
T PF03589_consen   17 ALDMKQSKAQFGVPVFKD--------------CERCGGRGYSR   45 (95)
T ss_pred             eccHHHhHhccCCchhhh--------------hhhhcCCCCCC
Confidence            489999999999996421              23478999995


No 33 
>PF07929 PRiA4_ORF3:  Plasmid pRiA4b ORF-3-like protein;  InterPro: IPR012912 Members of this family are similar to the protein product of ORF-3 (Q44206 from SWISSPROT) found on plasmid pRiA4 in the bacterium Agrobacterium rhizogenes. This plasmid is responsible for tumourigenesis at wound sites of plants infected by this bacterium, but the ORF-3 product does not seem to be involved in the pathogenetic process []. Other proteins found in this family are annotated as being putative TnpR resolvases (Q9LCU7 from SWISSPROT, Q50439 from SWISSPROT), but no further evidence was found to back this. Moreover, another member of this family is described as a probable lexA repressor (Q7UEI4 from SWISSPROT) and in fact carries a LexA DNA binding domain (IPR006199 from INTERPRO), but no references were found to expand on this. ; PDB: 2I1S_A.
Probab=20.93  E-value=1.1e+02  Score=25.50  Aligned_cols=35  Identities=20%  Similarity=0.503  Sum_probs=30.0

Q ss_pred             eeEEEecCc--ccceeeccCCCCCHHHHHHHHHHhhc
Q 026811          116 FVKVCMDGA--PYLRKVDLKTYKSYQELSDALAKMFS  150 (232)
Q Consensus       116 ~VKV~MdG~--p~gRKVDL~~~~sY~eL~~aLe~MF~  150 (232)
                      -+||..+|.  +|=|.|.+..--+..+|..+++..|+
T Consensus         6 ~lkV~L~~~~p~iwRri~Vp~~~tl~~Lh~~Iq~afg   42 (179)
T PF07929_consen    6 QLKVSLKGSKPPIWRRIEVPADITLADLHEVIQAAFG   42 (179)
T ss_dssp             EEEEEETT-SS-EEEEEEEETT-BHHHHHHHHHHHTT
T ss_pred             EEEEEEcCCCCCeEEEEEECCCCCHHHHHHHHHHHhC
Confidence            478999885  89999999999999999999999997


No 34 
>PLN02622 iron superoxide dismutase
Probab=20.49  E-value=1.9e+02  Score=26.64  Aligned_cols=53  Identities=28%  Similarity=0.401  Sum_probs=29.7

Q ss_pred             HHHHHHHHHhhccccCCCcCCCCcccccchhhhhhccCCCCeeeEEEcCCCCeEEecCcChhHHhhccceeEEecCccc
Q 026811          139 QELSDALAKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKGSEA  217 (232)
Q Consensus       139 ~eL~~aLe~MF~~~~~~~~~~~g~~~~~~e~~l~d~~~~se~vltYeDkdGDwMLVGDvPWemFv~s~KRLrImk~sea  217 (232)
                      ..|..++++=|+.|.  .     +...+.+..+ . +.||+|+..+.|.++                 +||+|+....+
T Consensus       142 g~L~~aI~~~FGS~d--~-----Fk~~F~~aA~-s-~fGSGW~WLv~d~~~-----------------g~L~I~~t~N~  194 (261)
T PLN02622        142 LGVLEQIEKDFGSFT--N-----FREKFTEAAL-T-LFGSGWVWLVLKREE-----------------RRLEVVKTSNA  194 (261)
T ss_pred             HHHHHHHHHHhcCHH--H-----HHHHHHHHHh-h-cCCceEEEEEEeCCC-----------------CeEEEEecCCC
Confidence            357777777777642  1     1100111111 1 358899998888754                 36777766554


Done!