BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026821
(232 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
In Complex With Initiation Factor 1. This File Contains
The 40s Subunit And Initiation Factor For Molecule 1
pdb|2XZN|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit
In Complex With Initiation Factor 1. This File Contains
The 40s Subunit And Initiation Factor For Molecule 2
Length = 343
Score = 30.0 bits (66), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 14/48 (29%), Positives = 21/48 (43%)
Query: 163 KKQLDALGGVGGVGFTPHVITVKAGEDISSKIFAFSQQGPRTVCILSA 210
+++ DA + + F P + V G D KIF Q VC + A
Sbjct: 249 QREFDAGSTINQIAFNPKLQWVAVGTDQGVKIFNLMTQSKAPVCTIEA 296
>pdb|3VTH|A Chain A, Crystal Structure Of Full-Length Hypf In The Phosphate-
And Nucleotide-Bound Form
pdb|3VTH|B Chain B, Crystal Structure Of Full-Length Hypf In The Phosphate-
And Nucleotide-Bound Form
pdb|3VTI|A Chain A, Crystal Structure Of Hype-Hypf Complex
pdb|3VTI|B Chain B, Crystal Structure Of Hype-Hypf Complex
Length = 761
Score = 30.0 bits (66), Expect = 1.3, Method: Composition-based stats.
Identities = 13/41 (31%), Positives = 21/41 (51%)
Query: 155 RGRPPGSGKKQLDALGGVGGVGFTPHVITVKAGEDISSKIF 195
RGR P +Q++ G V GVGF P V + ++ ++
Sbjct: 3 RGRVPQIQARQINIFGIVQGVGFRPFVFNIAQKYNLKGIVY 43
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.136 0.410
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,807,677
Number of Sequences: 62578
Number of extensions: 140908
Number of successful extensions: 267
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 265
Number of HSP's gapped (non-prelim): 2
length of query: 232
length of database: 14,973,337
effective HSP length: 96
effective length of query: 136
effective length of database: 8,965,849
effective search space: 1219355464
effective search space used: 1219355464
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)