Citrus Sinensis ID: 026830


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MQGVVLNPSYSRPHQTLDSPSCSRPASKSTKSFFGERVSLTRWRNPVCHSSCRLLLIRKRGAARRNVIKAVATPDSAIELPLTAENIESVLDEIRPYLISDGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLMEKIPEIVAVESVADEETGLELNEENIEKVLEEIRPYLVGAAGGSLELVTIDEPIVKVRITGPAAGVMTVRVAVTQKLREKIPAIAAVQLL
ccccccccccccccccccccccccccccccCEEECccEEECcccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHcccccccccccEEEEEECccEEEEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHHHcccccccccccEEEEEEcccEEEEEEcccHHHHHHHHHHHHHHHHHHccccEEEEEc
****VLN*SY***************ASK*TKSFFGERVSLTRWRNPVCHSSCRLLLIRKRG****************IELPLTAENIESVLDEIRPYLISDGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLMEKIPEIVAVESVADEETGLELNEENIEKVLEEIRPYLVGAAGGSLELVTIDEPIVKVRITGPAAGVMTVRVAVTQKLREKIPAIAAVQLL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQGVVLNPSYSRPHQTLDSPSCSRPASKSTKSFFGERVSLTRWRNPVCHSSCRLLLIRKRGAARRNVIKAVATPDSAIELPLTAENIESVLDEIRPYLISDGGNVALHEIDGNVVRLKLQGACGSCPSSVMTMKMGIERRLMEKIPEIVAVESVADEETGLELNEENIEKVLEEIRPYLVGAAGGSLELVTIDEPIVKVRITGPAAGVMTVRVAVTQKLREKIPAIAAVQLL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NifU-like protein 2, chloroplastic Molecular scaffold for [Fe-S] cluster assembly of chloroplastic iron-sulfur proteins. Required for biogenesis of ferredoxin, a major photosynthetic electron carrier containing [2Fe-2S] cluster. Required for the assembly of photosystem I complex.probableQ93W20

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z51, chain A
Confidence level:very confident
Coverage over the Query: 80-232
View the alignment between query and template
View the model in PyMOL
Template: 2LTL, chain A
Confidence level:probable
Coverage over the Query: 8-62
View the alignment between query and template
View the model in PyMOL