Query         026836
Match_columns 232
No_of_seqs    132 out of 177
Neff          2.8 
Searched_HMMs 46136
Date          Fri Mar 29 13:23:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026836.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026836hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0126 Predicted RNA-binding   99.8 4.8E-21   1E-25  167.2   4.5   87   20-114    85-173 (219)
  2 KOG2494 C3H1-type Zn-finger pr  95.1  0.0093   2E-07   56.3   1.5   30   63-92     32-62  (331)
  3 PF00642 zf-CCCH:  Zinc finger   94.8   0.013 2.8E-07   36.1   0.9   24   68-91      3-27  (27)
  4 smart00356 ZnF_C3H1 zinc finge  94.7   0.015 3.2E-07   34.2   0.9   23   69-91      5-27  (27)
  5 KOG0111 Cyclophilin-type pepti  93.7   0.026 5.5E-07   52.1   0.9   24   25-48     65-88  (298)
  6 KOG1763 Uncharacterized conser  88.5    0.24 5.1E-06   47.1   1.6   46   69-116    93-143 (343)
  7 PF13893 RRM_5:  RNA recognitio  86.4    0.14   3E-06   34.2  -0.9   24   23-46     32-55  (56)
  8 KOG0130 RNA-binding protein RB  84.2    0.28   6E-06   42.6  -0.3   27   26-53    128-154 (170)
  9 KOG0108 mRNA cleavage and poly  82.6    0.36 7.8E-06   46.9  -0.3   36   18-53     65-101 (435)
 10 KOG0147 Transcriptional coacti  70.6     1.1 2.3E-05   45.2  -0.8   32   23-55    331-362 (549)
 11 smart00361 RRM_1 RNA recogniti  69.1     2.1 4.4E-05   30.2   0.6   21   24-44     49-69  (70)
 12 PF00076 RRM_1:  RNA recognitio  68.6    0.93   2E-05   29.9  -1.2   22   22-43     49-70  (70)
 13 COG5252 Uncharacterized conser  63.9     3.4 7.3E-05   38.7   1.1   22   69-90     86-107 (299)
 14 TIGR01622 SF-CC1 splicing fact  59.0     3.3 7.2E-05   37.9   0.2   29   22-50    238-266 (457)
 15 COG5152 Uncharacterized conser  58.5     3.6 7.9E-05   37.8   0.3   32   68-100   141-173 (259)
 16 PLN03134 glycine-rich RNA-bind  56.6       5 0.00011   32.7   0.8   25   23-47     87-111 (144)
 17 COG0724 RNA-binding proteins (  56.1     3.2   7E-05   32.1  -0.4   27   22-48    167-193 (306)
 18 KOG2185 Predicted RNA-processi  52.6     7.1 0.00015   38.9   1.3   24   69-92    141-164 (486)
 19 PF11456 DUF3019:  Protein of u  52.3      24 0.00053   27.9   4.0   26   27-53     68-93  (102)
 20 KOG1039 Predicted E3 ubiquitin  51.9     6.2 0.00013   37.6   0.7   25   69-93      9-33  (344)
 21 KOG2202 U2 snRNP splicing fact  48.3     5.4 0.00012   37.1  -0.2   55   24-92    122-176 (260)
 22 KOG1813 Predicted E3 ubiquitin  45.5     9.5  0.0002   36.4   0.9   31   69-100   187-218 (313)
 23 PLN03120 nucleic acid binding   45.1      12 0.00026   34.6   1.5   27   28-55     59-85  (260)
 24 PF14608 zf-CCCH_2:  Zinc finge  44.1      14  0.0003   21.3   1.1   13   78-90      7-19  (19)
 25 KOG1595 CCCH-type Zn-finger pr  43.8     9.7 0.00021   38.5   0.7   24   68-91    236-259 (528)
 26 smart00360 RRM RNA recognition  39.1      14  0.0003   23.1   0.6   23   23-45     49-71  (71)
 27 smart00362 RRM_2 RNA recogniti  38.4      14  0.0003   23.3   0.5   22   24-45     51-72  (72)
 28 TIGR01649 hnRNP-L_PTB hnRNP-L/  38.2      13 0.00029   35.4   0.7   26   22-47    323-348 (481)
 29 TIGR01642 U2AF_lg U2 snRNP aux  37.3      10 0.00022   35.3  -0.3   25   24-48    349-373 (509)
 30 cd00590 RRM RRM (RNA recogniti  36.3     9.6 0.00021   24.1  -0.4   24   23-46     51-74  (74)
 31 KOG4207 Predicted splicing fac  36.2      15 0.00031   34.1   0.5   27   26-53     69-95  (256)
 32 PF08952 DUF1866:  Domain of un  31.1      18 0.00039   31.0   0.3   27   18-44     75-101 (146)
 33 TIGR01661 ELAV_HUD_SF ELAV/HuD  30.9      21 0.00045   31.4   0.6   24   24-47     57-80  (352)
 34 KOG0127 Nucleolar protein fibr  27.8      25 0.00055   36.4   0.7   22   26-47    172-193 (678)
 35 KOG0415 Predicted peptidyl pro  26.5      32 0.00069   34.2   1.1   62   21-95    290-356 (479)
 36 KOG1677 CCCH-type Zn-finger pr  25.9      34 0.00074   30.6   1.1   29   65-93    174-203 (332)
 37 TIGR01642 U2AF_lg U2 snRNP aux  25.6      34 0.00073   31.9   1.1   28   24-52    235-262 (509)
 38 KOG2494 C3H1-type Zn-finger pr  23.7      30 0.00066   33.3   0.4   27   68-95     71-97  (331)
 39 PLN03213 repressor of silencin  23.6      35 0.00075   35.3   0.8   25   25-49     63-87  (759)
 40 TIGR01659 sex-lethal sex-letha  22.0      22 0.00048   33.2  -0.8   25   23-47    160-184 (346)
 41 KOG0114 Predicted RNA-binding   21.5      41 0.00088   28.4   0.7   20   27-46     72-91  (124)

No 1  
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]
Probab=99.82  E-value=4.8e-21  Score=167.20  Aligned_cols=87  Identities=32%  Similarity=0.453  Sum_probs=73.9

Q ss_pred             ecceeeeeeeecCCCceecCceeEecccccccccccccHHHHHHHHHhhhhhHhhhcCCCCCCCCCcccccccccCCCCC
Q 026836           20 LKAIFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQRAANTGG   99 (232)
Q Consensus        20 ~~~~StiLAVDNlNG~~v~GR~irVDHv~~Yk~~~~edee~~~~~~e~~~v~~alq~~~C~~~~~ck~sh~~q~~~~t~~   99 (232)
                      -.|+||||||||||||+|+|||||||||.+|++|.+..+        ++.|+..||+++|.+..+-.+.++++.++++.|
T Consensus        85 EDQRSTILAVDN~NGiki~gRtirVDHv~~Yk~pk~~E~--------~d~~t~~L~~~g~~~~~~~~~~~~~~~~~~~k~  156 (219)
T KOG0126|consen   85 EDQRSTILAVDNLNGIKILGRTIRVDHVSNYKKPKESEE--------MDAVTKELQEEGCSPKNQSIIAQPEKPSPRYKT  156 (219)
T ss_pred             cCccceEEEEeccCCceecceeEEeeecccccCCchhhh--------hhHHHHHHhhccCCCCchhhhccccCCCccccc
Confidence            369999999999999999999999999999999966555        788999999999999999889999999999999


Q ss_pred             CC--CCCCccccccccc
Q 026836          100 GP--QDRSSRWGHEKFE  114 (232)
Q Consensus       100 ~s--ed~~~~~~~~k~~  114 (232)
                      +-  +++.+.+.+.+..
T Consensus       157 ~~e~~~~~~~K~~~~~~  173 (219)
T KOG0126|consen  157 VKEKEDRGSKKHSKKNK  173 (219)
T ss_pred             eeecccccchhhhhhhH
Confidence            95  4555444444333


No 2  
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription]
Probab=95.15  E-value=0.0093  Score=56.28  Aligned_cols=30  Identities=43%  Similarity=0.864  Sum_probs=26.6

Q ss_pred             HHHHhhhhhHhhhcCCCCCCCC-Cccccccc
Q 026836           63 RMREERGVCRAFQRGECTRGDG-CKFSHNEQ   92 (232)
Q Consensus        63 ~~~e~~~v~~alq~~~C~~~~~-ck~sh~~q   92 (232)
                      .+-..++||+.||++-|.+++- |||.|+..
T Consensus        32 ~~wl~~eVCReF~rn~C~R~d~~CkfaHP~~   62 (331)
T KOG2494|consen   32 TKWLTLEVCREFLRNTCSRGDRECKFAHPPK   62 (331)
T ss_pred             cchhHHHHHHHHHhccccCCCccccccCCCC
Confidence            4455789999999999999999 99999866


No 3  
>PF00642 zf-CCCH:  Zinc finger C-x8-C-x5-C-x3-H type (and similar);  InterPro: IPR000571 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents C-x8-C-x5-C-x3-H (CCCH) type Zinc finger (Znf) domains. Proteins containing CCCH Znf domains include Znf proteins from eukaryotes involved in cell cycle or growth phase-related regulation, e.g. human TIS11B (butyrate response factor 1), a probable regulatory protein involved in regulating the response to growth factors, and the mouse TTP growth factor-inducible nuclear protein, which has the same function. The mouse TTP protein is induced by growth factors. Another protein containing this domain is the human splicing factor U2AF 35kDa subunit, which plays a critical role in both constitutive and enhancer-dependent splicing by mediating essential protein-protein interactions and protein-RNA interactions required for 3' splice site selection. It has been shown that different CCCH-type Znf proteins interact with the 3'-untranslated region of various mRNA [, ]. This type of Znf is very often present in two copies. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 1M9O_A 1RGO_A 2CQE_A 2FC6_A 2D9M_A 2E5S_A 2RHK_C 2D9N_A 3D2S_A 3D2Q_C ....
Probab=94.81  E-value=0.013  Score=36.13  Aligned_cols=24  Identities=50%  Similarity=1.144  Sum_probs=18.0

Q ss_pred             hhhhHhhhc-CCCCCCCCCcccccc
Q 026836           68 RGVCRAFQR-GECTRGDGCKFSHNE   91 (232)
Q Consensus        68 ~~v~~alq~-~~C~~~~~ck~sh~~   91 (232)
                      ..+|..|++ |.|..|+.|+|+|++
T Consensus         3 ~~~C~~f~~~g~C~~G~~C~f~H~~   27 (27)
T PF00642_consen    3 TKLCRFFMRTGTCPFGDKCRFAHGE   27 (27)
T ss_dssp             SSB-HHHHHTS--TTGGGSSSBSSG
T ss_pred             cccChhhccCCccCCCCCcCccCCC
Confidence            357888888 889999999999985


No 4  
>smart00356 ZnF_C3H1 zinc finger.
Probab=94.66  E-value=0.015  Score=34.23  Aligned_cols=23  Identities=48%  Similarity=1.089  Sum_probs=20.6

Q ss_pred             hhhHhhhcCCCCCCCCCcccccc
Q 026836           69 GVCRAFQRGECTRGDGCKFSHNE   91 (232)
Q Consensus        69 ~v~~alq~~~C~~~~~ck~sh~~   91 (232)
                      .+|..|+.|.|..|..|+|+|+.
T Consensus         5 ~~C~~~~~g~C~~g~~C~~~H~~   27 (27)
T smart00356        5 ELCKFFKRGYCPYGDRCKFAHPL   27 (27)
T ss_pred             CcCcCccCCCCCCCCCcCCCCcC
Confidence            47899999999999999999973


No 5  
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=93.72  E-value=0.026  Score=52.11  Aligned_cols=24  Identities=33%  Similarity=0.552  Sum_probs=20.9

Q ss_pred             eeeeeecCCCceecCceeEecccc
Q 026836           25 SRFLPNNLNGAQILGRTIRVDHVA   48 (232)
Q Consensus        25 tiLAVDNlNG~~v~GR~irVDHv~   48 (232)
                      +-.||||||+.+|.||||+|....
T Consensus        65 AaaAiDNMnesEL~GrtirVN~Ak   88 (298)
T KOG0111|consen   65 AAAAIDNMNESELFGRTIRVNLAK   88 (298)
T ss_pred             hHHHhhcCchhhhcceeEEEeecC
Confidence            346899999999999999998763


No 6  
>KOG1763 consensus Uncharacterized conserved protein, contains CCCH-type Zn-finger [General function prediction only]
Probab=88.52  E-value=0.24  Score=47.08  Aligned_cols=46  Identities=39%  Similarity=0.754  Sum_probs=32.5

Q ss_pred             hhhHhhhcCCCCCCCCCcccccccccCCCCCCC-----CCCCcccccccccCC
Q 026836           69 GVCRAFQRGECTRGDGCKFSHNEQRAANTGGGP-----QDRSSRWGHEKFEGF  116 (232)
Q Consensus        69 ~v~~alq~~~C~~~~~ck~sh~~q~~~~t~~~s-----ed~~~~~~~~k~~~~  116 (232)
                      -||--|.+|.|+-|+.|+|||+....--+.-.+     -|+|  |.-++..+.
T Consensus        93 vvCafFk~g~C~KG~kCKFsHdl~~~~k~eK~dly~d~rdem--WD~~kl~~v  143 (343)
T KOG1763|consen   93 VVCAFFKQGTCTKGDKCKFSHDLAVERKKEKIDLYPDTRDEM--WDEEKLEEV  143 (343)
T ss_pred             HHHHHHhccCCCCCCcccccchHHHhhhccchhccccchhhh--hhHHHHHHH
Confidence            479999999999999999999987554433321     2335  866655543


No 7  
>PF13893 RRM_5:  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain); PDB: 2PE8_A 2PEH_A 2D9O_A 1A9N_D 2DIT_A 3S6E_A 2LQ5_A 1SJQ_A 2AD9_A 1X4D_A ....
Probab=86.38  E-value=0.14  Score=34.21  Aligned_cols=24  Identities=29%  Similarity=0.321  Sum_probs=21.2

Q ss_pred             eeeeeeeecCCCceecCceeEecc
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVDH   46 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVDH   46 (232)
                      -++..|+-+|||..+.|++|+|++
T Consensus        32 ~~A~~a~~~l~~~~~~g~~l~V~~   55 (56)
T PF13893_consen   32 EDAQKAIEQLNGRQFNGRPLKVSY   55 (56)
T ss_dssp             HHHHHHHHHHTTSEETTEEEEEEE
T ss_pred             HHHHHHHHHhCCCEECCcEEEEEE
Confidence            456778999999999999999986


No 8  
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only]
Probab=84.22  E-value=0.28  Score=42.64  Aligned_cols=27  Identities=33%  Similarity=0.476  Sum_probs=23.4

Q ss_pred             eeeeecCCCceecCceeEeccccccccc
Q 026836           26 RFLPNNLNGAQILGRTIRVDHVAKYKKK   53 (232)
Q Consensus        26 iLAVDNlNG~~v~GR~irVDHv~~Yk~~   53 (232)
                      --|||-|||+.|||.+|.||.+ .-+.|
T Consensus       128 q~A~~~~Ng~~ll~q~v~VDw~-Fv~gp  154 (170)
T KOG0130|consen  128 QAAIDALNGAELLGQNVSVDWC-FVKGP  154 (170)
T ss_pred             HHHHHhccchhhhCCceeEEEE-EecCC
Confidence            4589999999999999999999 55555


No 9  
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification]
Probab=82.57  E-value=0.36  Score=46.90  Aligned_cols=36  Identities=28%  Similarity=0.346  Sum_probs=28.9

Q ss_pred             eeecc-eeeeeeeecCCCceecCceeEeccccccccc
Q 026836           18 ISLKA-IFSRFLPNNLNGAQILGRTIRVDHVAKYKKK   53 (232)
Q Consensus        18 ~~~~~-~StiLAVDNlNG~~v~GR~irVDHv~~Yk~~   53 (232)
                      +.|+. ..|-.||-||||+++.||+|+|++..+++..
T Consensus        65 ~~~~~~~~~~~a~~~lNg~~~~gr~l~v~~~~~~~~~  101 (435)
T KOG0108|consen   65 CEFTDEETAERAIRNLNGAEFNGRKLRVNYASNRKNA  101 (435)
T ss_pred             EecCchhhHHHHHHhcCCcccCCceEEeecccccchh
Confidence            44444 4566799999999999999999998777665


No 10 
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription]
Probab=70.63  E-value=1.1  Score=45.23  Aligned_cols=32  Identities=28%  Similarity=0.322  Sum_probs=25.9

Q ss_pred             eeeeeeeecCCCceecCceeEeccccccccccc
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVDHVAKYKKKEE   55 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVDHv~~Yk~~~~   55 (232)
                      ..+-.|.-+|||..|+||+|+|-|| .|+....
T Consensus       331 ~~ar~a~e~lngfelAGr~ikV~~v-~~r~~~~  362 (549)
T KOG0147|consen  331 EDARKALEQLNGFELAGRLIKVSVV-TERVDTK  362 (549)
T ss_pred             HHHHHHHHHhccceecCceEEEEEe-eeecccc
Confidence            3455677899999999999999999 7776543


No 11 
>smart00361 RRM_1 RNA recognition motif.
Probab=69.08  E-value=2.1  Score=30.22  Aligned_cols=21  Identities=29%  Similarity=0.284  Sum_probs=18.0

Q ss_pred             eeeeeeecCCCceecCceeEe
Q 026836           24 FSRFLPNNLNGAQILGRTIRV   44 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irV   44 (232)
                      .+..|+.+|||..+.||+|+|
T Consensus        49 dA~~A~~~l~g~~~~gr~l~~   69 (70)
T smart00361       49 DAARAIVDLNGRYFDGRTVKA   69 (70)
T ss_pred             HHHHHHHHhCCCEECCEEEEe
Confidence            345688999999999999986


No 12 
>PF00076 RRM_1:  RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain);  InterPro: IPR000504 Many eukaryotic proteins containing one or more copies of a putative RNA-binding domain of about 90 amino acids are known to bind single-stranded RNAs [, , ]. The largest group of single strand RNA-binding proteins is the eukaryotic RNA recognition motif (RRM) family that contains an eight amino acid RNP-1 consensus sequence [, ]. RRM proteins have a variety of RNA binding preferences and functions, and include heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing (SR, U2AF, Sxl), protein components of small nuclear ribonucleoproteins (U1 and U2 snRNPs), and proteins that regulate RNA stability and translation (PABP, La, Hu) [, , ]. The RRM in heterodimeric splicing factor U2 snRNP auxiliary factor (U2AF) appears to have two RRM-like domains with specialised features for protein recognition []. The motif also appears in a few single stranded DNA binding proteins. The typical RRM consists of four anti-parallel beta-strands and two alpha-helices arranged in a beta-alpha-beta-beta-alpha-beta fold with side chains that stack with RNA bases. Specificity of RNA binding is determined by multiple contacts with surrounding amino acids. A third helix is present during RNA binding in some cases []. The RRM is reviewed in a number of publications [, , ].; GO: 0003676 nucleic acid binding; PDB: 2RNE_A 2DGO_A 2DO4_A 1YTY_B 2VOO_B 2VOP_A 2VON_B 1ZH5_B 2VOD_A 1S79_A ....
Probab=68.65  E-value=0.93  Score=29.92  Aligned_cols=22  Identities=36%  Similarity=0.394  Sum_probs=18.7

Q ss_pred             ceeeeeeeecCCCceecCceeE
Q 026836           22 AIFSRFLPNNLNGAQILGRTIR   43 (232)
Q Consensus        22 ~~StiLAVDNlNG~~v~GR~ir   43 (232)
                      .-++..|+++|||..|.|++||
T Consensus        49 ~~~a~~a~~~l~g~~~~~~~ir   70 (70)
T PF00076_consen   49 EEDAEKALEELNGKKINGRKIR   70 (70)
T ss_dssp             HHHHHHHHHHHTTEEETTEEEE
T ss_pred             HHHHHHHHHHcCCCEECccCcC
Confidence            3456778999999999999996


No 13 
>COG5252 Uncharacterized conserved protein, contains CCCH-type Zn-finger protein [General function prediction only]
Probab=63.87  E-value=3.4  Score=38.71  Aligned_cols=22  Identities=45%  Similarity=1.061  Sum_probs=20.8

Q ss_pred             hhhHhhhcCCCCCCCCCccccc
Q 026836           69 GVCRAFQRGECTRGDGCKFSHN   90 (232)
Q Consensus        69 ~v~~alq~~~C~~~~~ck~sh~   90 (232)
                      -||--|.-+-|+-|++|+|+|.
T Consensus        86 ~vcalF~~~~c~kg~~ckF~h~  107 (299)
T COG5252          86 VVCALFLNKTCAKGDACKFAHG  107 (299)
T ss_pred             HHHHHhccCccccCchhhhhcc
Confidence            5889999999999999999999


No 14 
>TIGR01622 SF-CC1 splicing factor, CC1-like family. A homologous gene from Plasmodium falciparum was identified in the course of the analysis of that genome at TIGR and was included in the model.
Probab=58.97  E-value=3.3  Score=37.94  Aligned_cols=29  Identities=24%  Similarity=0.266  Sum_probs=24.3

Q ss_pred             ceeeeeeeecCCCceecCceeEecccccc
Q 026836           22 AIFSRFLPNNLNGAQILGRTIRVDHVAKY   50 (232)
Q Consensus        22 ~~StiLAVDNlNG~~v~GR~irVDHv~~Y   50 (232)
                      .-.+..||..|||+.|.|++|+|.++..+
T Consensus       238 ~e~A~~A~~~l~g~~i~g~~i~v~~a~~~  266 (457)
T TIGR01622       238 AEEAKEALEVMNGFELAGRPIKVGYAQDS  266 (457)
T ss_pred             HHHHHHHHHhcCCcEECCEEEEEEEccCC
Confidence            34567789999999999999999998543


No 15 
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=58.51  E-value=3.6  Score=37.76  Aligned_cols=32  Identities=38%  Similarity=0.815  Sum_probs=24.0

Q ss_pred             hhhhHhhhc-CCCCCCCCCcccccccccCCCCCC
Q 026836           68 RGVCRAFQR-GECTRGDGCKFSHNEQRAANTGGG  100 (232)
Q Consensus        68 ~~v~~alq~-~~C~~~~~ck~sh~~q~~~~t~~~  100 (232)
                      -.||.-+.+ |-|+-|++|+|.|+-. .-.+||-
T Consensus       141 pdVCKdyk~TGYCGYGDsCKflH~R~-D~KtGWk  173 (259)
T COG5152         141 PDVCKDYKETGYCGYGDSCKFLHDRS-DFKTGWK  173 (259)
T ss_pred             cccccchhhcccccCCchhhhhhhhh-hhhcccc
Confidence            358887755 5599999999999753 4566776


No 16 
>PLN03134 glycine-rich RNA-binding protein 4; Provisional
Probab=56.57  E-value=5  Score=32.75  Aligned_cols=25  Identities=24%  Similarity=0.359  Sum_probs=21.1

Q ss_pred             eeeeeeeecCCCceecCceeEeccc
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVDHV   47 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVDHv   47 (232)
                      -.+..||..|||..|.|+.|+|+..
T Consensus        87 e~A~~Al~~lng~~i~Gr~l~V~~a  111 (144)
T PLN03134         87 GAATAAISEMDGKELNGRHIRVNPA  111 (144)
T ss_pred             HHHHHHHHHcCCCEECCEEEEEEeC
Confidence            3455678899999999999999987


No 17 
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only]
Probab=56.09  E-value=3.2  Score=32.13  Aligned_cols=27  Identities=26%  Similarity=0.373  Sum_probs=23.8

Q ss_pred             ceeeeeeeecCCCceecCceeEecccc
Q 026836           22 AIFSRFLPNNLNGAQILGRTIRVDHVA   48 (232)
Q Consensus        22 ~~StiLAVDNlNG~~v~GR~irVDHv~   48 (232)
                      ..+...||.+|||..+.|++|.|+.+.
T Consensus       167 ~~~~~~a~~~~~~~~~~~~~~~v~~~~  193 (306)
T COG0724         167 EESAEKAIEELNGKELEGRPLRVQKAQ  193 (306)
T ss_pred             HHHHHHHHHHcCCCeECCceeEeeccc
Confidence            446788999999999999999999973


No 18 
>KOG2185 consensus Predicted RNA-processing protein, contains G-patch domain [RNA processing and modification]
Probab=52.56  E-value=7.1  Score=38.87  Aligned_cols=24  Identities=38%  Similarity=0.937  Sum_probs=21.5

Q ss_pred             hhhHhhhcCCCCCCCCCccccccc
Q 026836           69 GVCRAFQRGECTRGDGCKFSHNEQ   92 (232)
Q Consensus        69 ~v~~alq~~~C~~~~~ck~sh~~q   92 (232)
                      -.|.-|.++.|--+..|||||--.
T Consensus       141 kpC~ffLeg~CRF~enCRfSHG~~  164 (486)
T KOG2185|consen  141 KPCKFFLEGRCRFGENCRFSHGLD  164 (486)
T ss_pred             ccchHhhccccccCcccccccCcc
Confidence            369999999999999999999754


No 19 
>PF11456 DUF3019:  Protein of unknown function (DUF3019);  InterPro: IPR021559  This is a bacterial family of uncharacterised proteins. 
Probab=52.34  E-value=24  Score=27.89  Aligned_cols=26  Identities=19%  Similarity=0.243  Sum_probs=22.1

Q ss_pred             eeeecCCCceecCceeEeccccccccc
Q 026836           27 FLPNNLNGAQILGRTIRVDHVAKYKKK   53 (232)
Q Consensus        27 LAVDNlNG~~v~GR~irVDHv~~Yk~~   53 (232)
                      .-+|.-+|..|++-.|+|-++. |+.+
T Consensus        68 ~L~~~~~~~~la~~~v~V~~~~-~k~R   93 (102)
T PF11456_consen   68 SLRDSDTGQPLAQVKVKVTWVS-PKVR   93 (102)
T ss_pred             EEEeCCCCcEEEEEEEEEEEec-cCcC
Confidence            4469999999999999999996 6654


No 20 
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=51.87  E-value=6.2  Score=37.58  Aligned_cols=25  Identities=36%  Similarity=0.923  Sum_probs=23.5

Q ss_pred             hhhHhhhcCCCCCCCCCcccccccc
Q 026836           69 GVCRAFQRGECTRGDGCKFSHNEQR   93 (232)
Q Consensus        69 ~v~~alq~~~C~~~~~ck~sh~~q~   93 (232)
                      .||+.||+|-|.-|+.|+|+|+...
T Consensus         9 tic~~~~~g~c~~g~~cr~~h~~~~   33 (344)
T KOG1039|consen    9 TICKYYQKGNCKFGDLCRLSHSLPD   33 (344)
T ss_pred             hhhhhcccccccccceeeeeccCch
Confidence            7999999999999999999999874


No 21 
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification]
Probab=48.32  E-value=5.4  Score=37.06  Aligned_cols=55  Identities=27%  Similarity=0.517  Sum_probs=46.2

Q ss_pred             eeeeeeecCCCceecCceeEecccccccccccccHHHHHHHHHhhhhhHhhhcCCCCCCCCCccccccc
Q 026836           24 FSRFLPNNLNGAQILGRTIRVDHVAKYKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQ   92 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irVDHv~~Yk~~~~edee~~~~~~e~~~v~~alq~~~C~~~~~ck~sh~~q   92 (232)
                      ++..|+.-|||-=+.|++|--+-+.-+..              ....|..|-.+.|++|..|-|-|.-.
T Consensus       122 ~ae~a~~~lnnRw~~G~pi~ae~~pvT~~--------------rea~C~~~e~~~C~rG~~CnFmH~k~  176 (260)
T KOG2202|consen  122 DAEAALEDLNNRWYNGRPIHAELSPVTDF--------------REAICGQFERTECSRGGACNFMHVKR  176 (260)
T ss_pred             HHHHHHHHHcCccccCCcceeeecCcCch--------------hhhhhcccccccCCCCCcCcchhhhh
Confidence            46678899999999999998888733332              46799999999999999999999873


No 22 
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=45.52  E-value=9.5  Score=36.35  Aligned_cols=31  Identities=32%  Similarity=0.823  Sum_probs=21.1

Q ss_pred             hhhHhhh-cCCCCCCCCCcccccccccCCCCCC
Q 026836           69 GVCRAFQ-RGECTRGDGCKFSHNEQRAANTGGG  100 (232)
Q Consensus        69 ~v~~alq-~~~C~~~~~ck~sh~~q~~~~t~~~  100 (232)
                      +||..+- .|.|+-|++|+|+|+-- .=.+||-
T Consensus       187 DicKdykeTgycg~gdSckFlh~r~-DyK~GWq  218 (313)
T KOG1813|consen  187 DICKDYKETGYCGYGDSCKFLHDRS-DYKAGWQ  218 (313)
T ss_pred             hhhhhhHhhCcccccchhhhhhhhh-hccccce
Confidence            4566554 56799999999999742 2334444


No 23 
>PLN03120 nucleic acid binding protein; Provisional
Probab=45.06  E-value=12  Score=34.56  Aligned_cols=27  Identities=22%  Similarity=0.390  Sum_probs=23.0

Q ss_pred             eeecCCCceecCceeEeccccccccccc
Q 026836           28 LPNNLNGAQILGRTIRVDHVAKYKKKEE   55 (232)
Q Consensus        28 AVDNlNG~~v~GR~irVDHv~~Yk~~~~   55 (232)
                      || .|||..|.|+.|+|..+..|..+.+
T Consensus        59 Al-lLnG~~l~gr~V~Vt~a~~~~~p~~   85 (260)
T PLN03120         59 AL-LLSGATIVDQSVTITPAEDYQLPPE   85 (260)
T ss_pred             HH-HhcCCeeCCceEEEEeccCCCCCcc
Confidence            44 5999999999999999998987643


No 24 
>PF14608 zf-CCCH_2:  Zinc finger C-x8-C-x5-C-x3-H type
Probab=44.07  E-value=14  Score=21.32  Aligned_cols=13  Identities=62%  Similarity=1.334  Sum_probs=11.6

Q ss_pred             CCCCCCCCccccc
Q 026836           78 ECTRGDGCKFSHN   90 (232)
Q Consensus        78 ~C~~~~~ck~sh~   90 (232)
                      .|+.++.|.|+|+
T Consensus         7 ~C~~~~~C~f~HP   19 (19)
T PF14608_consen    7 NCTNGDNCPFSHP   19 (19)
T ss_pred             CCCCCCcCccCCc
Confidence            4999999999995


No 25 
>KOG1595 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=43.85  E-value=9.7  Score=38.49  Aligned_cols=24  Identities=38%  Similarity=1.064  Sum_probs=21.4

Q ss_pred             hhhhHhhhcCCCCCCCCCcccccc
Q 026836           68 RGVCRAFQRGECTRGDGCKFSHNE   91 (232)
Q Consensus        68 ~~v~~alq~~~C~~~~~ck~sh~~   91 (232)
                      =.+|++|..|.|-+||.|-|.|-+
T Consensus       236 ~tpCPefrkG~C~rGD~CEyaHgv  259 (528)
T KOG1595|consen  236 STPCPEFRKGSCERGDSCEYAHGV  259 (528)
T ss_pred             CccCcccccCCCCCCCccccccce
Confidence            357999999999999999999865


No 26 
>smart00360 RRM RNA recognition motif.
Probab=39.10  E-value=14  Score=23.11  Aligned_cols=23  Identities=26%  Similarity=0.340  Sum_probs=18.6

Q ss_pred             eeeeeeeecCCCceecCceeEec
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVD   45 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVD   45 (232)
                      .++..|+..|+|..+.|+.|+|.
T Consensus        49 ~~a~~a~~~~~~~~~~~~~~~v~   71 (71)
T smart00360       49 EDAEKALEALNGKELDGRPLKVK   71 (71)
T ss_pred             HHHHHHHHHcCCCeeCCcEEEeC
Confidence            34556788999999999999883


No 27 
>smart00362 RRM_2 RNA recognition motif.
Probab=38.38  E-value=14  Score=23.29  Aligned_cols=22  Identities=32%  Similarity=0.462  Sum_probs=18.2

Q ss_pred             eeeeeeecCCCceecCceeEec
Q 026836           24 FSRFLPNNLNGAQILGRTIRVD   45 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irVD   45 (232)
                      .+..||..|+|..|.|++|+|.
T Consensus        51 ~a~~a~~~~~~~~~~~~~i~v~   72 (72)
T smart00362       51 DAEKAIEALNGTKLGGRPLRVE   72 (72)
T ss_pred             HHHHHHHHhCCcEECCEEEeeC
Confidence            4556788999999999999873


No 28 
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family. Included in this family of heterogeneous ribonucleoproteins are PTB (polypyrimidine tract binding protein ) and hnRNP-L. These proteins contain four RNA recognition motifs (rrm: pfam00067).
Probab=38.21  E-value=13  Score=35.36  Aligned_cols=26  Identities=23%  Similarity=0.457  Sum_probs=22.8

Q ss_pred             ceeeeeeeecCCCceecCceeEeccc
Q 026836           22 AIFSRFLPNNLNGAQILGRTIRVDHV   47 (232)
Q Consensus        22 ~~StiLAVDNlNG~~v~GR~irVDHv   47 (232)
                      .-++..||.+|||..|.|++|+|...
T Consensus       323 ~~~A~~Ai~~lng~~l~g~~l~v~~s  348 (481)
T TIGR01649       323 PYQAQLALTHLNGVKLFGKPLRVCPS  348 (481)
T ss_pred             HHHHHHHHHHhCCCEECCceEEEEEc
Confidence            34677899999999999999999876


No 29 
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=37.31  E-value=10  Score=35.31  Aligned_cols=25  Identities=16%  Similarity=0.219  Sum_probs=21.6

Q ss_pred             eeeeeeecCCCceecCceeEecccc
Q 026836           24 FSRFLPNNLNGAQILGRTIRVDHVA   48 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irVDHv~   48 (232)
                      ++..||..|||+.|.|++|.|.++.
T Consensus       349 ~a~~A~~~l~g~~~~~~~l~v~~a~  373 (509)
T TIGR01642       349 VTDVAIAALNGKDTGDNKLHVQRAC  373 (509)
T ss_pred             HHHHHHHHcCCCEECCeEEEEEECc
Confidence            4557888999999999999999873


No 30 
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability. This domain is 90 amino acids in length and consists of a four-stranded beta-sheet packed against two alpha-helices.  RRM usually interacts with ssRNA, but is also known to interact with ssDNA as well as proteins. RRM binds a variable number of nucleotides, ranging from two to eight.  The active site includes three aromatic side-chains located within the conserved RNP1 and RNP2 motifs of the domain. The RRM domain is found in a variety heterogeneous nuclear ribonucleoproteins (hnRNPs), proteins implicated in regulation of alternative splicing, and protein components of small nuclear ribonucleoproteins (snRNPs).
Probab=36.28  E-value=9.6  Score=24.14  Aligned_cols=24  Identities=29%  Similarity=0.378  Sum_probs=20.1

Q ss_pred             eeeeeeeecCCCceecCceeEecc
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVDH   46 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVDH   46 (232)
                      -++.+|++.|+|..+.|++|.|.+
T Consensus        51 ~~a~~a~~~~~~~~~~~~~~~v~~   74 (74)
T cd00590          51 EDAEKALEALNGKELGGRPLRVEF   74 (74)
T ss_pred             HHHHHHHHHhCCCeECCeEEEEeC
Confidence            356778999999999999999853


No 31 
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification]
Probab=36.17  E-value=15  Score=34.12  Aligned_cols=27  Identities=26%  Similarity=0.481  Sum_probs=23.5

Q ss_pred             eeeeecCCCceecCceeEeccccccccc
Q 026836           26 RFLPNNLNGAQILGRTIRVDHVAKYKKK   53 (232)
Q Consensus        26 iLAVDNlNG~~v~GR~irVDHv~~Yk~~   53 (232)
                      --|+|-|.|+.|.||-|+|--+ .|-.+
T Consensus        69 edA~damDG~~ldgRelrVq~a-rygr~   95 (256)
T KOG4207|consen   69 EDALDAMDGAVLDGRELRVQMA-RYGRP   95 (256)
T ss_pred             HHHHHhhcceeeccceeeehhh-hcCCC
Confidence            3489999999999999999877 78776


No 32 
>PF08952 DUF1866:  Domain of unknown function (DUF1866) ;  InterPro: IPR015047 This domain, found in synaptojanin, has no known function. ; PDB: 1UFW_A 2DNR_A.
Probab=31.14  E-value=18  Score=30.98  Aligned_cols=27  Identities=26%  Similarity=0.491  Sum_probs=20.4

Q ss_pred             eeecceeeeeeeecCCCceecCceeEe
Q 026836           18 ISLKAIFSRFLPNNLNGAQILGRTIRV   44 (232)
Q Consensus        18 ~~~~~~StiLAVDNlNG~~v~GR~irV   44 (232)
                      +.+.--.+-||+=.|+|++|+|++|+|
T Consensus        75 VTF~dg~sALaals~dg~~v~g~~l~i  101 (146)
T PF08952_consen   75 VTFRDGQSALAALSLDGIQVNGRTLKI  101 (146)
T ss_dssp             EEESSCHHHHHHHHGCCSEETTEEEEE
T ss_pred             EEECccHHHHHHHccCCcEECCEEEEE
Confidence            333334455777789999999999998


No 33 
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor. These proteins contain 3 RNA-recognition motifs (rrm: pfam00076).
Probab=30.91  E-value=21  Score=31.37  Aligned_cols=24  Identities=29%  Similarity=0.354  Sum_probs=21.1

Q ss_pred             eeeeeeecCCCceecCceeEeccc
Q 026836           24 FSRFLPNNLNGAQILGRTIRVDHV   47 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irVDHv   47 (232)
                      .+..||..|||..|.|++|+|.+.
T Consensus        57 ~A~~Ai~~l~g~~l~g~~i~v~~a   80 (352)
T TIGR01661        57 DAEKAVNSLNGLRLQNKTIKVSYA   80 (352)
T ss_pred             HHHHHHhhcccEEECCeeEEEEee
Confidence            567788999999999999999765


No 34 
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=27.80  E-value=25  Score=36.37  Aligned_cols=22  Identities=32%  Similarity=0.400  Sum_probs=19.8

Q ss_pred             eeeeecCCCceecCceeEeccc
Q 026836           26 RFLPNNLNGAQILGRTIRVDHV   47 (232)
Q Consensus        26 iLAVDNlNG~~v~GR~irVDHv   47 (232)
                      --|+-+|||-+|.||+|-||+.
T Consensus       172 ~~Al~~~N~~~i~gR~VAVDWA  193 (678)
T KOG0127|consen  172 EKALEFFNGNKIDGRPVAVDWA  193 (678)
T ss_pred             HHHHHhccCceecCceeEEeee
Confidence            3578899999999999999987


No 35 
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones]
Probab=26.52  E-value=32  Score=34.18  Aligned_cols=62  Identities=24%  Similarity=0.373  Sum_probs=41.7

Q ss_pred             cceeeeeeeecCCCceecCceeEecccc---c--ccccccccHHHHHHHHHhhhhhHhhhcCCCCCCCCCcccccccccC
Q 026836           21 KAIFSRFLPNNLNGAQILGRTIRVDHVA---K--YKKKEEEDEETRQRMREERGVCRAFQRGECTRGDGCKFSHNEQRAA   95 (232)
Q Consensus        21 ~~~StiLAVDNlNG~~v~GR~irVDHv~---~--Yk~~~~edee~~~~~~e~~~v~~alq~~~C~~~~~ck~sh~~q~~~   95 (232)
                      ++-||--|.=.|..+-|-.|.|.||...   .  |+++....+             --+....|..+-+-+|+|-.+-.+
T Consensus       290 n~escE~AyFKMdNvLIDDrRIHVDFSQSVsk~k~r~k~~~~~-------------~d~~~~d~~~~~~~k~~~kd~~~~  356 (479)
T KOG0415|consen  290 NKESCEQAYFKMDNVLIDDRRIHVDFSQSVSKVKYRQKGSQKE-------------TDHRAKDCVGGPSSKFIHKDQNRP  356 (479)
T ss_pred             chhhHHHHHhhhcceeeccceEEeehhhhhhhhhccccccccc-------------cchhhhccccCCcccchhccCCCC
Confidence            3456666666677788999999999853   3  666543332             124456788888888888766544


No 36 
>KOG1677 consensus CCCH-type Zn-finger protein [General function prediction only]
Probab=25.93  E-value=34  Score=30.60  Aligned_cols=29  Identities=34%  Similarity=0.846  Sum_probs=24.4

Q ss_pred             HHhhhhhHhhhc-CCCCCCCCCcccccccc
Q 026836           65 REERGVCRAFQR-GECTRGDGCKFSHNEQR   93 (232)
Q Consensus        65 ~e~~~v~~alq~-~~C~~~~~ck~sh~~q~   93 (232)
                      +.....|..|++ |-|.-|.-|+|.|....
T Consensus       174 ~~kt~lC~~f~~tG~C~yG~rC~F~H~~~~  203 (332)
T KOG1677|consen  174 KYKTKLCPKFQKTGLCKYGSRCRFIHGEPE  203 (332)
T ss_pred             CCCCcCCCccccCCCCCCCCcCeecCCCcc
Confidence            335568999999 88999999999999873


No 37 
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor. Members of this subfamily are found in plants, metazoa and fungi.
Probab=25.62  E-value=34  Score=31.85  Aligned_cols=28  Identities=11%  Similarity=0.113  Sum_probs=22.2

Q ss_pred             eeeeeeecCCCceecCceeEecccccccc
Q 026836           24 FSRFLPNNLNGAQILGRTIRVDHVAKYKK   52 (232)
Q Consensus        24 StiLAVDNlNG~~v~GR~irVDHv~~Yk~   52 (232)
                      .+..|+ .|||+.|.|+.|+|.....|.+
T Consensus       235 ~A~~Al-~l~g~~~~g~~l~v~r~~~~~~  262 (509)
T TIGR01642       235 EATFAM-ALDSIIYSNVFLKIRRPHDYIP  262 (509)
T ss_pred             HHhhhh-cCCCeEeeCceeEecCccccCC
Confidence            344677 5999999999999987766763


No 38 
>KOG2494 consensus C3H1-type Zn-finger protein [Transcription]
Probab=23.72  E-value=30  Score=33.27  Aligned_cols=27  Identities=33%  Similarity=0.671  Sum_probs=22.6

Q ss_pred             hhhhHhhhcCCCCCCCCCcccccccccC
Q 026836           68 RGVCRAFQRGECTRGDGCKFSHNEQRAA   95 (232)
Q Consensus        68 ~~v~~alq~~~C~~~~~ck~sh~~q~~~   95 (232)
                      -..|.-+|.|+|++-- |||.|+.+---
T Consensus        71 v~aC~Ds~kgrCsR~n-CkylHpp~hlk   97 (331)
T KOG2494|consen   71 VIACFDSQKGRCSREN-CKYLHPPQHLK   97 (331)
T ss_pred             EEEEeccccCccCccc-ceecCCChhhh
Confidence            4568999999999988 99999987433


No 39 
>PLN03213 repressor of silencing 3; Provisional
Probab=23.57  E-value=35  Score=35.34  Aligned_cols=25  Identities=20%  Similarity=0.274  Sum_probs=20.8

Q ss_pred             eeeeeecCCCceecCceeEeccccc
Q 026836           25 SRFLPNNLNGAQILGRTIRVDHVAK   49 (232)
Q Consensus        25 tiLAVDNlNG~~v~GR~irVDHv~~   49 (232)
                      -.-||.-|||++++||.|+|....-
T Consensus        63 eeKAISaLNGAEWKGR~LKVNKAKP   87 (759)
T PLN03213         63 LTKLFSTYNGCVWKGGRLRLEKAKE   87 (759)
T ss_pred             HHHHHHHhcCCeecCceeEEeeccH
Confidence            3457778999999999999998843


No 40 
>TIGR01659 sex-lethal sex-lethal family splicing factor. This model describes the sex-lethal family of splicing factors found in Dipteran insects. The sex-lethal phenotype, however, may be limited to the Melanogasters and closely related species. In Drosophila the protein acts as an inhibitor of splicing. This subfamily is most closely related to the ELAV/HUD subfamily of splicing factors (TIGR01661).
Probab=22.01  E-value=22  Score=33.23  Aligned_cols=25  Identities=24%  Similarity=0.278  Sum_probs=21.4

Q ss_pred             eeeeeeeecCCCceecCceeEeccc
Q 026836           23 IFSRFLPNNLNGAQILGRTIRVDHV   47 (232)
Q Consensus        23 ~StiLAVDNlNG~~v~GR~irVDHv   47 (232)
                      -++..||..|||+.|.|++|+|...
T Consensus       160 e~A~~Ai~~LnG~~l~gr~i~V~~a  184 (346)
T TIGR01659       160 ADSQRAIKNLNGITVRNKRLKVSYA  184 (346)
T ss_pred             HHHHHHHHHcCCCccCCceeeeecc
Confidence            3566788899999999999999865


No 41 
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only]
Probab=21.47  E-value=41  Score=28.39  Aligned_cols=20  Identities=20%  Similarity=0.104  Sum_probs=17.8

Q ss_pred             eeeecCCCceecCceeEecc
Q 026836           27 FLPNNLNGAQILGRTIRVDH   46 (232)
Q Consensus        27 LAVDNlNG~~v~GR~irVDH   46 (232)
                      -|+|.|+|..|.+|-|.|-+
T Consensus        72 ~A~dhlsg~n~~~ryl~vly   91 (124)
T KOG0114|consen   72 KACDHLSGYNVDNRYLVVLY   91 (124)
T ss_pred             HHHHHhcccccCCceEEEEe
Confidence            48999999999999999853


Done!