Query         026846
Match_columns 232
No_of_seqs    215 out of 3169
Neff          9.7 
Searched_HMMs 46136
Date          Fri Mar 29 13:33:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026846.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026846hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462 C2H2-type Zn-finger pr  99.9 1.3E-25 2.9E-30  174.3   2.5  100    1-111   166-265 (279)
  2 KOG2462 C2H2-type Zn-finger pr  99.9 4.1E-23 8.9E-28  160.5   5.2  104    2-117   136-242 (279)
  3 KOG1074 Transcriptional repres  99.8 2.5E-20 5.5E-25  163.0   0.2   49    1-51    358-406 (958)
  4 KOG1074 Transcriptional repres  99.7 4.4E-18 9.6E-23  149.1   4.4   55   60-116   880-934 (958)
  5 KOG3576 Ovo and related transc  99.7 1.6E-17 3.4E-22  123.6   0.2  107    1-116   122-239 (267)
  6 KOG3576 Ovo and related transc  99.6 6.3E-17 1.4E-21  120.5   0.3   88   21-117   114-201 (267)
  7 KOG3623 Homeobox transcription  99.5 3.8E-15 8.3E-20  129.1   3.1  107    1-111   215-331 (1007)
  8 KOG3623 Homeobox transcription  99.5 6.8E-15 1.5E-19  127.6   0.3   87   21-118   891-977 (1007)
  9 KOG3608 Zn finger proteins [Ge  99.4 3.1E-13 6.6E-18  108.7   3.4  107    1-111   184-314 (467)
 10 KOG3608 Zn finger proteins [Ge  99.4 3.4E-13 7.4E-18  108.4   2.9  115    1-123   268-386 (467)
 11 PHA00733 hypothetical protein   99.1 1.6E-10 3.5E-15   82.8   4.7   83   22-115    38-125 (128)
 12 PLN03086 PRLI-interacting fact  99.0 5.4E-10 1.2E-14   97.5   5.8   98    1-114   458-565 (567)
 13 PF13465 zf-H2C2_2:  Zinc-finge  98.9 1.2E-09 2.6E-14   55.7   2.3   26   11-38      1-26  (26)
 14 PHA02768 hypothetical protein;  98.9 1.2E-09 2.6E-14   65.1   2.0   43   24-105     5-47  (55)
 15 PHA02768 hypothetical protein;  98.7 8.1E-09 1.8E-13   61.5   2.0   39    1-43     10-48  (55)
 16 PF13465 zf-H2C2_2:  Zinc-finge  98.6 2.9E-09 6.3E-14   54.3  -0.9   23   77-101     4-26  (26)
 17 PLN03086 PRLI-interacting fact  98.6 2.6E-08 5.7E-13   87.1   3.4   76   23-112   452-537 (567)
 18 KOG3993 Transcription factor (  98.6 4.8E-08   1E-12   80.9   4.1  112    1-119   272-386 (500)
 19 KOG3993 Transcription factor (  98.5 1.1E-07 2.4E-12   78.8   4.0  113    1-117   300-486 (500)
 20 PHA00616 hypothetical protein   98.3 2.9E-07 6.3E-12   52.2   1.7   32   24-57      1-32  (44)
 21 COG5189 SFP1 Putative transcri  98.3 3.3E-07 7.2E-12   73.4   2.5   73   21-110   346-419 (423)
 22 PHA00732 hypothetical protein   98.2 1.1E-06 2.4E-11   57.3   2.7   24   24-49      1-25  (79)
 23 PHA00733 hypothetical protein   98.1 3.8E-06 8.3E-11   60.2   4.5   74    2-84     46-124 (128)
 24 PF05605 zf-Di19:  Drought indu  98.1 8.8E-06 1.9E-10   49.2   4.6   53   24-114     2-54  (54)
 25 PHA00616 hypothetical protein   97.9 5.8E-06 1.3E-10   47.0   1.6   27   87-115     1-27  (44)
 26 PF00096 zf-C2H2:  Zinc finger,  97.8 1.4E-05 3.1E-10   39.2   1.9   23   25-49      1-23  (23)
 27 PF00096 zf-C2H2:  Zinc finger,  97.8 1.9E-05 4.1E-10   38.7   1.8   22   88-111     1-22  (23)
 28 PF13894 zf-C2H2_4:  C2H2-type   97.7 2.6E-05 5.7E-10   38.4   2.2   24   88-113     1-24  (24)
 29 PHA00732 hypothetical protein   97.6 4.1E-05 8.9E-10   49.9   2.4   42    1-50      6-48  (79)
 30 PF13912 zf-C2H2_6:  C2H2-type   97.6 3.9E-05 8.4E-10   39.2   1.6   26   87-114     1-26  (27)
 31 COG5048 FOG: Zn-finger [Genera  97.5 2.7E-05 5.9E-10   67.0   0.4  115    1-115   294-444 (467)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.4 0.00011 2.4E-09   36.0   2.1   24   25-50      1-24  (24)
 33 PF12756 zf-C2H2_2:  C2H2 type   97.4 9.3E-05   2E-09   50.4   2.4   73   26-112     1-73  (100)
 34 PF06524 NOA36:  NOA36 protein;  97.4 0.00071 1.5E-08   53.1   7.0   27   19-48    137-163 (314)
 35 PF05605 zf-Di19:  Drought indu  97.2  0.0008 1.7E-08   40.5   4.2   45    1-50      7-53  (54)
 36 PF13912 zf-C2H2_6:  C2H2-type   97.1 0.00025 5.5E-09   36.1   1.5   25   24-50      1-25  (27)
 37 PF09237 GAGA:  GAGA factor;  I  97.0 0.00063 1.4E-08   39.6   2.6   40   13-54     12-52  (54)
 38 PF09237 GAGA:  GAGA factor;  I  96.8  0.0018 3.9E-08   37.7   3.1   31   83-115    20-50  (54)
 39 smart00355 ZnF_C2H2 zinc finge  96.7  0.0015 3.3E-08   32.3   2.2   24   25-50      1-24  (26)
 40 PF12756 zf-C2H2_2:  C2H2 type   96.7  0.0013 2.8E-08   44.7   2.3   47    1-49      4-73  (100)
 41 smart00355 ZnF_C2H2 zinc finge  96.6  0.0019 4.1E-08   32.0   2.1   22   88-111     1-22  (26)
 42 KOG4377 Zn-finger protein [Gen  96.6  0.0054 1.2E-07   51.4   5.6  106    1-113   278-427 (480)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.5  0.0017 3.8E-08   31.9   1.6   24   88-114     1-24  (24)
 44 KOG4173 Alpha-SNAP protein [In  96.0  0.0011 2.5E-08   50.2  -1.0   86   22-115    77-172 (253)
 45 PF06524 NOA36:  NOA36 protein;  95.9  0.0088 1.9E-07   47.2   3.5   18   86-105   208-225 (314)
 46 PF13909 zf-H2C2_5:  C2H2-type   95.9  0.0073 1.6E-07   29.6   2.1   23   25-50      1-23  (24)
 47 PF12874 zf-met:  Zinc-finger o  95.8  0.0056 1.2E-07   30.3   1.5   23   25-49      1-23  (25)
 48 PRK04860 hypothetical protein;  95.7  0.0059 1.3E-07   45.5   1.8   30   71-102   127-156 (160)
 49 PF12874 zf-met:  Zinc-finger o  95.6  0.0075 1.6E-07   29.8   1.5   22   88-111     1-22  (25)
 50 COG5048 FOG: Zn-finger [Genera  95.0   0.016 3.5E-07   49.8   2.5   77   23-104   288-368 (467)
 51 KOG1146 Homeobox protein [Gene  94.8  0.0099 2.1E-07   56.8   0.7   88    4-111   444-540 (1406)
 52 PF12171 zf-C2H2_jaz:  Zinc-fin  94.8    0.01 2.2E-07   30.1   0.5   22   88-111     2-23  (27)
 53 PF09538 FYDLN_acid:  Protein o  94.8   0.052 1.1E-06   37.6   4.1   17   84-102    23-39  (108)
 54 COG5189 SFP1 Putative transcri  94.2   0.035 7.7E-07   45.2   2.3   30   84-113   346-375 (423)
 55 PF12171 zf-C2H2_jaz:  Zinc-fin  94.2   0.016 3.5E-07   29.3   0.3   23   25-49      2-24  (27)
 56 COG5236 Uncharacterized conser  93.3    0.59 1.3E-05   38.8   7.9   95    8-117   200-309 (493)
 57 COG4049 Uncharacterized protei  93.1   0.049 1.1E-06   32.3   1.1   33   81-115    11-43  (65)
 58 PF13913 zf-C2HC_2:  zinc-finge  93.0    0.09 1.9E-06   26.1   1.9   21   88-111     3-23  (25)
 59 smart00451 ZnF_U1 U1-like zinc  91.8    0.13 2.8E-06   27.5   1.7   23   87-111     3-25  (35)
 60 smart00451 ZnF_U1 U1-like zinc  91.3    0.17 3.6E-06   27.1   1.8   24   24-49      3-26  (35)
 61 KOG4124 Putative transcription  91.2   0.057 1.2E-06   44.5  -0.2   72   22-109   347-418 (442)
 62 KOG1146 Homeobox protein [Gene  91.0    0.34 7.4E-06   46.9   4.5   75   22-117  1282-1356(1406)
 63 KOG2893 Zn finger protein [Gen  89.3    0.11 2.3E-06   40.7  -0.1   40    1-46     15-54  (341)
 64 TIGR02300 FYDLN_acid conserved  88.8    0.95 2.1E-05   32.0   4.3   20   84-105    23-42  (129)
 65 KOG2893 Zn finger protein [Gen  88.5    0.13 2.8E-06   40.3  -0.1   51   22-114     9-59  (341)
 66 KOG2231 Predicted E3 ubiquitin  88.3    0.88 1.9E-05   41.4   4.9   93    8-110   161-260 (669)
 67 PF02892 zf-BED:  BED zinc fing  88.1     0.3 6.6E-06   27.8   1.3   28   84-113    13-44  (45)
 68 KOG2785 C2H2-type Zn-finger pr  87.2    0.89 1.9E-05   38.3   4.0   81   24-112     3-91  (390)
 69 COG5236 Uncharacterized conser  85.0     1.1 2.3E-05   37.3   3.3   89   25-115   152-246 (493)
 70 PF02724 CDC45:  CDC45-like pro  84.5    0.67 1.5E-05   42.4   2.2   10   40-49     39-48  (622)
 71 PF07800 DUF1644:  Protein of u  84.3     3.9 8.4E-05   30.2   5.6   56   62-119    83-138 (162)
 72 KOG4173 Alpha-SNAP protein [In  84.1    0.37   8E-06   36.9   0.3   47    2-48    112-168 (253)
 73 smart00614 ZnF_BED BED zinc fi  82.6       1 2.3E-05   26.3   1.8   25   88-114    19-48  (50)
 74 KOG2231 Predicted E3 ubiquitin  82.4     1.2 2.6E-05   40.6   2.9  103    7-114   125-237 (669)
 75 PF12013 DUF3505:  Protein of u  81.6     1.2 2.5E-05   30.9   2.0   26   87-114    80-109 (109)
 76 KOG3130 Uncharacterized conser  79.9    0.86 1.9E-05   38.6   1.1    7  105-111   145-151 (514)
 77 KOG2482 Predicted C2H2-type Zn  75.0     3.9 8.5E-05   34.1   3.5   21    1-21    200-222 (423)
 78 COG4049 Uncharacterized protei  74.0     1.8 3.9E-05   25.8   1.0   31   18-50     11-41  (65)
 79 PF04959 ARS2:  Arsenite-resist  71.4     2.7 5.7E-05   33.0   1.7   32   84-117    74-105 (214)
 80 PF05443 ROS_MUCR:  ROS/MUCR tr  69.2     3.2 6.9E-05   29.9   1.6   27   85-116    70-96  (132)
 81 KOG2186 Cell growth-regulating  68.3       3 6.6E-05   33.2   1.4   47   24-110     3-49  (276)
 82 PF03145 Sina:  Seven in absent  68.2     4.2 9.2E-05   31.3   2.3   58   24-117    14-75  (198)
 83 PF05443 ROS_MUCR:  ROS/MUCR tr  67.6     3.3 7.2E-05   29.8   1.4   24   25-53     73-96  (132)
 84 KOG2785 C2H2-type Zn-finger pr  67.0     6.1 0.00013   33.5   3.0   46    1-48    171-242 (390)
 85 PF15269 zf-C2H2_7:  Zinc-finge  66.9      10 0.00023   21.5   3.0   22   88-111    21-42  (54)
 86 KOG3064 RNA-binding nuclear pr  66.7     2.8 6.1E-05   33.4   1.0   17   95-111   108-124 (303)
 87 KOG0127 Nucleolar protein fibr  62.0     4.2   9E-05   36.1   1.2   11   95-105   158-168 (678)
 88 PF12013 DUF3505:  Protein of u  59.2     8.1 0.00017   26.6   2.1   27   25-51     81-109 (109)
 89 TIGR00622 ssl1 transcription f  55.2      40 0.00087   23.5   4.9   84   22-111    13-103 (112)
 90 COG4957 Predicted transcriptio  54.8     6.2 0.00013   28.3   0.9   25   25-54     77-101 (148)
 91 KOG3540 Beta amyloid precursor  54.7      11 0.00025   32.9   2.6    7   85-91    114-120 (615)
 92 KOG4124 Putative transcription  53.9      11 0.00023   31.7   2.2   31   83-116   209-239 (442)
 93 PF12907 zf-met2:  Zinc-binding  50.9     5.1 0.00011   22.3   0.0   27   88-116     2-31  (40)
 94 smart00734 ZnF_Rad18 Rad18-lik  50.1      15 0.00032   18.2   1.6   20   88-110     2-21  (26)
 95 PRK09678 DNA-binding transcrip  48.4     7.1 0.00015   24.9   0.4   20   85-104    25-44  (72)
 96 PF02176 zf-TRAF:  TRAF-type zi  47.1      10 0.00022   22.7   1.0   26   22-48      7-32  (60)
 97 PF04959 ARS2:  Arsenite-resist  47.0      14  0.0003   29.0   1.8   28   22-51     75-102 (214)
 98 COG5137 Histone chaperone invo  46.1     8.8 0.00019   29.9   0.6   14   88-103    97-110 (279)
 99 KOG2482 Predicted C2H2-type Zn  43.8      18  0.0004   30.3   2.1   29   87-117   195-224 (423)
100 TIGR00373 conserved hypothetic  43.4      30 0.00065   25.7   3.1   24   18-43    103-126 (158)
101 KOG4167 Predicted DNA-binding   42.8     5.7 0.00012   36.6  -0.9   25   24-50    792-816 (907)
102 KOG0127 Nucleolar protein fibr  40.8      16 0.00034   32.7   1.4    6   86-91    125-130 (678)
103 PF04780 DUF629:  Protein of un  40.4      19 0.00041   31.7   1.9   32   85-118    55-86  (466)
104 COG1592 Rubrerythrin [Energy p  39.7      19 0.00041   27.0   1.5   13   83-97    145-157 (166)
105 PF03286 Pox_Ag35:  Pox virus A  39.4 1.8E+02  0.0039   22.6   7.5   17   95-111    10-26  (200)
106 cd00350 rubredoxin_like Rubred  38.7      22 0.00048   18.6   1.3   11   85-97     15-25  (33)
107 KOG3408 U1-like Zn-finger-cont  38.5      19  0.0004   25.4   1.2   26   84-111    54-79  (129)
108 smart00531 TFIIE Transcription  38.5      23 0.00049   25.9   1.8   20   20-41     95-114 (147)
109 PF13717 zinc_ribbon_4:  zinc-r  37.3      21 0.00044   19.2   1.1   14   85-100    23-36  (36)
110 KOG4167 Predicted DNA-binding   36.9     9.5 0.00021   35.2  -0.5   27   86-114   791-817 (907)
111 PF13719 zinc_ribbon_5:  zinc-r  36.6      24 0.00051   19.1   1.3   14   85-100    23-36  (37)
112 KOG1280 Uncharacterized conser  35.8      47   0.001   28.0   3.3   33   22-56     77-109 (381)
113 TIGR02098 MJ0042_CXXC MJ0042 f  35.4      23  0.0005   19.0   1.1   12   87-100    25-36  (38)
114 PF08790 zf-LYAR:  LYAR-type C2  35.4     7.7 0.00017   19.7  -0.8   19   88-109     1-19  (28)
115 PF09538 FYDLN_acid:  Protein o  35.3   1E+02  0.0023   21.3   4.6   12   88-101    10-21  (108)
116 PRK00464 nrdR transcriptional   34.3      22 0.00047   26.4   1.1   16   87-104    28-43  (154)
117 COG4530 Uncharacterized protei  33.7      40 0.00087   23.3   2.2   20   84-106    23-42  (129)
118 cd00729 rubredoxin_SM Rubredox  33.6      27 0.00059   18.5   1.1   10   86-97     17-26  (34)
119 KOG2295 C2H2 Zn-finger protein  33.5      27 0.00059   31.3   1.7   33   84-116   506-538 (648)
120 PF01363 FYVE:  FYVE zinc finge  32.8      24 0.00052   21.8   1.0   14   85-100    23-36  (69)
121 smart00154 ZnF_AN1 AN1-like Zi  31.8      22 0.00047   19.6   0.6   14   87-102    12-25  (39)
122 COG5152 Uncharacterized conser  30.5      16 0.00035   28.0  -0.1   15   23-39    195-209 (259)
123 cd00065 FYVE FYVE domain; Zinc  30.2      41 0.00088   19.7   1.7   15   85-101    16-30  (57)
124 PF09986 DUF2225:  Uncharacteri  30.1      21 0.00045   28.0   0.5   23   23-47      4-26  (214)
125 PF04606 Ogr_Delta:  Ogr/Delta-  29.7      11 0.00023   21.7  -0.9   18   85-102    23-40  (47)
126 PRK06266 transcription initiat  29.7      47   0.001   25.2   2.3   21   20-42    113-133 (178)
127 PTZ00255 60S ribosomal protein  29.5      24 0.00052   23.5   0.6   16   85-102    52-67  (90)
128 COG2888 Predicted Zn-ribbon RN  29.4      51  0.0011   20.1   1.9   11   85-97     48-58  (61)
129 cd00924 Cyt_c_Oxidase_Vb Cytoc  28.8      26 0.00056   23.8   0.7   20   79-101    72-91  (97)
130 KOG0717 Molecular chaperone (D  28.6      30 0.00066   30.3   1.2   23   88-112   293-315 (508)
131 KOG3214 Uncharacterized Zn rib  27.9      25 0.00055   23.8   0.5   13   87-101    47-59  (109)
132 KOG4434 Molecular chaperone SE  27.8      22 0.00047   30.2   0.2   11   35-45     68-78  (520)
133 KOG2071 mRNA cleavage and poly  27.2      40 0.00088   30.5   1.8   28   22-51    416-443 (579)
134 KOG2051 Nonsense-mediated mRNA  27.1      68  0.0015   31.3   3.2    8   95-102   788-795 (1128)
135 KOG0782 Predicted diacylglycer  26.5      10 0.00022   34.1  -2.0   30   10-41    239-268 (1004)
136 PF10276 zf-CHCC:  Zinc-finger   26.1      36 0.00078   18.9   0.8   13   86-100    28-40  (40)
137 TIGR00280 L37a ribosomal prote  25.9      24 0.00051   23.6   0.1   15   85-101    51-65  (91)
138 smart00064 FYVE Protein presen  25.9      47   0.001   20.4   1.5   14   86-101    25-38  (68)
139 COG1997 RPL43A Ribosomal prote  25.8      47   0.001   22.0   1.4   15   85-101    51-65  (89)
140 PF10571 UPF0547:  Uncharacteri  25.1      35 0.00075   16.9   0.6   11   88-100    15-25  (26)
141 KOG3362 Predicted BBOX Zn-fing  24.9      35 0.00076   24.8   0.8   38   55-111   114-151 (156)
142 KOG2593 Transcription initiati  24.6      42 0.00092   29.1   1.4   22   20-43    124-145 (436)
143 KOG4377 Zn-finger protein [Gen  24.2      58  0.0013   28.1   2.1   74   24-100   271-360 (480)
144 COG1571 Predicted DNA-binding   23.5      55  0.0012   28.5   1.9   29   61-102   352-380 (421)
145 PHA00626 hypothetical protein   23.1      38 0.00082   20.4   0.6   16   85-102    21-36  (59)
146 PRK03976 rpl37ae 50S ribosomal  23.0      28  0.0006   23.2  -0.0   15   85-101    52-66  (90)
147 PF09845 DUF2072:  Zn-ribbon co  22.8      37  0.0008   24.3   0.6   15   87-103     1-15  (131)
148 PF01428 zf-AN1:  AN1-like Zinc  22.6      27 0.00059   19.5  -0.1   15   86-102    12-26  (43)
149 KOG3555 Ca2+-binding proteogly  22.3      55  0.0012   27.7   1.6   16   34-49    156-171 (434)
150 KOG1813 Predicted E3 ubiquitin  22.2      93   0.002   25.7   2.8   14   23-38    240-253 (313)
151 KOG2186 Cell growth-regulating  21.6      48   0.001   26.7   1.0   49    2-55      9-57  (276)
152 KOG0782 Predicted diacylglycer  21.6      33 0.00071   31.0   0.1   27   74-102   240-266 (1004)
153 KOG3555 Ca2+-binding proteogly  21.3      60  0.0013   27.4   1.6   15    6-20    158-172 (434)
154 PRK14890 putative Zn-ribbon RN  20.9      81  0.0018   19.2   1.7   11   85-97     46-56  (59)
155 KOG0978 E3 ubiquitin ligase in  20.9     8.5 0.00018   35.5  -3.6   23   84-108   675-697 (698)
156 PF05477 SURF2:  Surfeit locus   20.2      89  0.0019   25.1   2.3    9   21-29     22-30  (244)
157 PF14353 CpXC:  CpXC protein     20.1      23  0.0005   25.1  -0.9   23   87-111    38-60  (128)

No 1  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.91  E-value=1.3e-25  Score=174.30  Aligned_cols=100  Identities=19%  Similarity=0.304  Sum_probs=76.9

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccc
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYG   80 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~   80 (232)
                      +|+|+|..-..|+.|+++|+  -+++|.+  |||+|.+..-|+.|+|+|||+|||.|     ..|+|.|--+++|+.||+
T Consensus       166 ~C~K~YvSmpALkMHirTH~--l~c~C~i--CGKaFSRPWLLQGHiRTHTGEKPF~C-----~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  166 YCGKVYVSMPALKMHIRTHT--LPCECGI--CGKAFSRPWLLQGHIRTHTGEKPFSC-----PHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             CCCceeeehHHHhhHhhccC--CCccccc--ccccccchHHhhcccccccCCCCccC-----CcccchhcchHHHHHHHH
Confidence            57777777777777777776  5677765  77777777777777777777777777     677777777777877887


Q ss_pred             cCCCCCCccCCcccccccccChHHHHHHHHh
Q 026846           81 SASSERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        81 ~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      +|.+.|+|.|..  |+|+|...+.|.+|...
T Consensus       237 THS~~K~~qC~~--C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  237 THSDVKKHQCPR--CGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcCCccccCcc--hhhHHHHHHHHHHhhhh
Confidence            777777777776  77777777777777654


No 2  
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=99.88  E-value=4.1e-23  Score=160.51  Aligned_cols=104  Identities=28%  Similarity=0.476  Sum_probs=95.2

Q ss_pred             ccccCCChHHHHHHHHHhcC---CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccc
Q 026846            2 KAVAFSLDFNLRSHMKTHSQ---ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGV   78 (232)
Q Consensus         2 C~~~f~~~~~L~~H~~~H~~---~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H   78 (232)
                      |||.+.+.++|.+|.++|..   .+.|.|.+  |+|.|.+...|+.|+|+|+  -|+.|     .+|||.|.+.=.|..|
T Consensus       136 Cgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~--C~K~YvSmpALkMHirTH~--l~c~C-----~iCGKaFSRPWLLQGH  206 (279)
T KOG2462|consen  136 CGKSYSTSSNLSRHKQTHRSLDSKKAFSCKY--CGKVYVSMPALKMHIRTHT--LPCEC-----GICGKAFSRPWLLQGH  206 (279)
T ss_pred             cccccccccccchhhcccccccccccccCCC--CCceeeehHHHhhHhhccC--CCccc-----ccccccccchHHhhcc
Confidence            99999999999999999964   67899986  9999999999999999997  45555     8999999999999999


Q ss_pred             cccCCCCCCccCCcccccccccChHHHHHHHHhhCCCCC
Q 026846           79 YGSASSERPYACPYEGCEKAYIHEYKLKLHLKREHPGHM  117 (232)
Q Consensus        79 ~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~  117 (232)
                      +|+|+|+|||.|..  |+|+|+.++||+.||++ |...+
T Consensus       207 iRTHTGEKPF~C~h--C~kAFADRSNLRAHmQT-HS~~K  242 (279)
T KOG2462|consen  207 IRTHTGEKPFSCPH--CGKAFADRSNLRAHMQT-HSDVK  242 (279)
T ss_pred             cccccCCCCccCCc--ccchhcchHHHHHHHHh-hcCCc
Confidence            99999999999988  99999999999999999 55544


No 3  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.78  E-value=2.5e-20  Score=162.98  Aligned_cols=49  Identities=33%  Similarity=0.594  Sum_probs=47.0

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcC
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHE   51 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~   51 (232)
                      ||.|+|...+.|..|+|.|+|+|||+|.+  ||.+|.++.+|+.|...|+.
T Consensus       358 ~CakvfgS~SaLqiHlRSHTGERPfqCnv--CG~~FSTkGNLKvH~~rH~e  406 (958)
T KOG1074|consen  358 FCAKVFGSDSALQIHLRSHTGERPFQCNV--CGNRFSTKGNLKVHFQRHRE  406 (958)
T ss_pred             hhHhhcCchhhhhhhhhccCCCCCeeecc--cccccccccceeeeeeeccc
Confidence            79999999999999999999999999987  99999999999999998875


No 4  
>KOG1074 consensus Transcriptional repressor SALM [Transcription]
Probab=99.71  E-value=4.4e-18  Score=149.10  Aligned_cols=55  Identities=15%  Similarity=0.272  Sum_probs=50.2

Q ss_pred             cCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChHHHHHHHHhhCCCC
Q 026846           60 RYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKREHPGH  116 (232)
Q Consensus        60 ~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~  116 (232)
                      .+|..|++.|.....|..|+++|+|+|||.|.+  |++.|+.+.+|+.||.+|+-..
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~f--C~~aFttrgnLKvHMgtH~w~q  934 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHF--CEEAFTTRGNLKVHMGTHMWVQ  934 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchh--hhhhhhhhhhhhhhhccccccC
Confidence            566889999999999999999999999999999  9999999999999999855443


No 5  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.65  E-value=1.6e-17  Score=123.63  Aligned_cols=107  Identities=24%  Similarity=0.382  Sum_probs=83.4

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccc
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYG   80 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~   80 (232)
                      +|+|.|..+.-|.+|++.|...|.|-|.+  |||.|...-.|++|+|+|+|.+||+|     ..|+|.|.++-.|..|++
T Consensus       122 vCgK~F~lQRmlnrh~kch~~vkr~lct~--cgkgfndtfdlkrh~rthtgvrpykc-----~~c~kaftqrcsleshl~  194 (267)
T KOG3576|consen  122 VCGKKFGLQRMLNRHLKCHSDVKRHLCTF--CGKGFNDTFDLKRHTRTHTGVRPYKC-----SLCEKAFTQRCSLESHLK  194 (267)
T ss_pred             hhhhhhhHHHHHHHHhhhccHHHHHHHhh--ccCcccchhhhhhhhccccCccccch-----hhhhHHHHhhccHHHHHH
Confidence            48888888888888888888888888876  88888888888888888888888887     778888888888888765


Q ss_pred             c-CC----------CCCCccCCcccccccccChHHHHHHHHhhCCCC
Q 026846           81 S-AS----------SERPYACPYEGCEKAYIHEYKLKLHLKREHPGH  116 (232)
Q Consensus        81 ~-H~----------~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~  116 (232)
                      . |.          ..|.|.|..  ||.+-.+...+..|++.+|...
T Consensus       195 kvhgv~~~yaykerr~kl~vced--cg~t~~~~e~~~~h~~~~hp~S  239 (267)
T KOG3576|consen  195 KVHGVQHQYAYKERRAKLYVCED--CGYTSERPEVYYLHLKLHHPFS  239 (267)
T ss_pred             HHcCchHHHHHHHhhhheeeecc--cCCCCCChhHHHHHHHhcCCCC
Confidence            3 32          346788854  8887777777788888777653


No 6  
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=99.62  E-value=6.3e-17  Score=120.48  Aligned_cols=88  Identities=24%  Similarity=0.427  Sum_probs=81.5

Q ss_pred             CCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCccccccccc
Q 026846           21 QENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYI  100 (232)
Q Consensus        21 ~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~  100 (232)
                      +...|.|.+  |+|+|..+..|.+|++.|...|.|.|     +.|||-|...-.|++|+|+|+|.+||+|..  |+|+|+
T Consensus       114 d~d~ftCrv--CgK~F~lQRmlnrh~kch~~vkr~lc-----t~cgkgfndtfdlkrh~rthtgvrpykc~~--c~kaft  184 (267)
T KOG3576|consen  114 DQDSFTCRV--CGKKFGLQRMLNRHLKCHSDVKRHLC-----TFCGKGFNDTFDLKRHTRTHTGVRPYKCSL--CEKAFT  184 (267)
T ss_pred             CCCeeeeeh--hhhhhhHHHHHHHHhhhccHHHHHHH-----hhccCcccchhhhhhhhccccCccccchhh--hhHHHH
Confidence            345699997  99999999999999999999888888     899999999999999999999999999988  999999


Q ss_pred             ChHHHHHHHHhhCCCCC
Q 026846          101 HEYKLKLHLKREHPGHM  117 (232)
Q Consensus       101 ~~~~l~~H~~~~h~~~~  117 (232)
                      ++..|..|++..|+...
T Consensus       185 qrcsleshl~kvhgv~~  201 (267)
T KOG3576|consen  185 QRCSLESHLKKVHGVQH  201 (267)
T ss_pred             hhccHHHHHHHHcCchH
Confidence            99999999999887643


No 7  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.53  E-value=3.8e-15  Score=129.14  Aligned_cols=107  Identities=21%  Similarity=0.336  Sum_probs=90.2

Q ss_pred             CccccCCChHHHHHHHH-Hhc-CCCcccCCCCCCCccccchhhHHHHHHHhcCCCCC-------ccC-CcCCCCCccccC
Q 026846            1 MKAVAFSLDFNLRSHMK-THS-QENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAA-------VEV-PRYATPPERITK   70 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~-~H~-~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~-------~c~-~~~~~~c~~~~~   70 (232)
                      ||.+.+.+...|+.|++ +|. .+-.|.|.+  |.++|.++..|.+||.+|.....-       .|. ..+|+-|+|.|+
T Consensus       215 ycdrgykrltslkeHikyrhekne~nfsC~l--CsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFK  292 (1007)
T KOG3623|consen  215 YCDRGYKRLTSLKEHIKYRHEKNEPNFSCML--CSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFK  292 (1007)
T ss_pred             hHHHHHHHHHHHHHHHHHHHhhCCCCCcchh--hhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhh
Confidence            68888888999999987 453 566799975  999999999999999999632221       122 345599999999


Q ss_pred             CCCCcccccccCCCCCCccCCcccccccccChHHHHHHHHh
Q 026846           71 TPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        71 ~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      -+.+|+-|+|+|.|+|||.|..  |+|.|..++.+..||-.
T Consensus       293 fKHHLKEHlRIHSGEKPfeCpn--CkKRFSHSGSySSHmSS  331 (1007)
T KOG3623|consen  293 FKHHLKEHLRIHSGEKPFECPN--CKKRFSHSGSYSSHMSS  331 (1007)
T ss_pred             hHHHHHhhheeecCCCCcCCcc--cccccccCCcccccccc
Confidence            9999999999999999999976  99999999999999854


No 8  
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=99.47  E-value=6.8e-15  Score=127.60  Aligned_cols=87  Identities=18%  Similarity=0.301  Sum_probs=79.1

Q ss_pred             CCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCccccccccc
Q 026846           21 QENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYI  100 (232)
Q Consensus        21 ~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~  100 (232)
                      ..-+|.|..  |.|.|...+.|.+|..-|+|++||+|     .+|.|.|+.+.+|.-|+|+|.|+|||.|.-  |+|.|.
T Consensus       891 e~gmyaCDq--CDK~FqKqSSLaRHKYEHsGqRPyqC-----~iCkKAFKHKHHLtEHkRLHSGEKPfQCdK--ClKRFS  961 (1007)
T KOG3623|consen  891 EDGMYACDQ--CDKAFQKQSSLARHKYEHSGQRPYQC-----IICKKAFKHKHHLTEHKRLHSGEKPFQCDK--CLKRFS  961 (1007)
T ss_pred             ccccchHHH--HHHHHHhhHHHHHhhhhhcCCCCccc-----chhhHhhhhhhhhhhhhhhccCCCcchhhh--hhhhcc
Confidence            355799975  99999999999999999999999999     899999999999999999999999999977  999999


Q ss_pred             ChHHHHHHHHhhCCCCCC
Q 026846          101 HEYKLKLHLKREHPGHMS  118 (232)
Q Consensus       101 ~~~~l~~H~~~~h~~~~~  118 (232)
                      .++....||.  |.....
T Consensus       962 HSGSYSQHMN--HRYSYC  977 (1007)
T KOG3623|consen  962 HSGSYSQHMN--HRYSYC  977 (1007)
T ss_pred             cccchHhhhc--cchhcc
Confidence            9999999985  666553


No 9  
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.37  E-value=3.1e-13  Score=108.71  Aligned_cols=107  Identities=21%  Similarity=0.393  Sum_probs=79.8

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhc--CCCCCcc---------------------
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHH--EKNAAVE---------------------   57 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~--~~~~~~c---------------------   57 (232)
                      .|-+.|..++.|+.|+++|+++|...|+  .||.-|..+..|..|++..+  ...+|+|                     
T Consensus       184 ~Ct~~~~~k~~LreH~r~Hs~eKvvACp--~Cg~~F~~~tkl~DH~rRqt~l~~n~fqC~~C~KrFaTeklL~~Hv~rHv  261 (467)
T KOG3608|consen  184 MCTKHMGNKYRLREHIRTHSNEKVVACP--HCGELFRTKTKLFDHLRRQTELNTNSFQCAQCFKRFATEKLLKSHVVRHV  261 (467)
T ss_pred             hhhhhhccHHHHHHHHHhcCCCeEEecc--hHHHHhccccHHHHHHHhhhhhcCCchHHHHHHHHHhHHHHHHHHHHHhh
Confidence            3778899999999999999999998885  48888888888888887755  3455654                     


Q ss_pred             CCcCCCCCccccCCCCCccccccc-CCCCCCccCCcccccccccChHHHHHHHHh
Q 026846           58 VPRYATPPERITKTPKPPAGVYGS-ASSERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        58 ~~~~~~~c~~~~~~~~~l~~H~~~-H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      ..+.|++|.-....++-|.+|++. |...|||+|.-  |.+.|.+.+.|.+|..+
T Consensus       262 n~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~--Cd~~c~~esdL~kH~~~  314 (467)
T KOG3608|consen  262 NCYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDE--CDTRCVRESDLAKHVQV  314 (467)
T ss_pred             hcccccccccCCCChHHHHHHHHhhhccCCCccccc--hhhhhccHHHHHHHHHh
Confidence            235667777777777777777764 77777777754  77777666666666654


No 10 
>KOG3608 consensus Zn finger proteins [General function prediction only]
Probab=99.35  E-value=3.4e-13  Score=108.44  Aligned_cols=115  Identities=19%  Similarity=0.310  Sum_probs=77.2

Q ss_pred             CccccCCChHHHHHHHHH-hcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCccccc
Q 026846            1 MKAVAFSLDFNLRSHMKT-HSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVY   79 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~-H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~   79 (232)
                      +|.......+.|..||+. |+..|||+|.  .|.++|...+.|.+|+..|. +..|.|-.   +.|...|+....+++|+
T Consensus       268 lCdmtc~~~ssL~~H~r~rHs~dkpfKCd--~Cd~~c~~esdL~kH~~~HS-~~~y~C~h---~~C~~s~r~~~q~~~H~  341 (467)
T KOG3608|consen  268 LCDMTCSSASSLTTHIRYRHSKDKPFKCD--ECDTRCVRESDLAKHVQVHS-KTVYQCEH---PDCHYSVRTYTQMRRHF  341 (467)
T ss_pred             ccccCCCChHHHHHHHHhhhccCCCcccc--chhhhhccHHHHHHHHHhcc-ccceecCC---CCCcHHHHHHHHHHHHH
Confidence            356666666777777663 6667777775  47777777777777777665 44455522   44666777777777777


Q ss_pred             ccCC-C--CCCccCCcccccccccChHHHHHHHHhhCCCCCCCcccc
Q 026846           80 GSAS-S--ERPYACPYEGCEKAYIHEYKLKLHLKREHPGHMSDENAE  123 (232)
Q Consensus        80 ~~H~-~--~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~~~~~~~  123 (232)
                      +-|. |  ..+|.|..  |.+.|++..+|..|+++.|....|..-..
T Consensus       342 ~evhEg~np~~Y~CH~--Cdr~ft~G~~L~~HL~kkH~f~~PsGh~R  386 (467)
T KOG3608|consen  342 LEVHEGNNPILYACHC--CDRFFTSGKSLSAHLMKKHGFRLPSGHKR  386 (467)
T ss_pred             HHhccCCCCCceeeec--chhhhccchhHHHHHHHhhcccCCCCCCc
Confidence            7543 4  34688877  88888888888888887787766554433


No 11 
>PHA00733 hypothetical protein
Probab=99.07  E-value=1.6e-10  Score=82.76  Aligned_cols=83  Identities=12%  Similarity=0.041  Sum_probs=54.6

Q ss_pred             CCcccCCCCCCCccccchhhHHHH--HHH---hcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCccccc
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNH--IAS---HHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCE   96 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H--~~~---h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~   96 (232)
                      .+++.|.+  |.+.|.....|..|  ++.   +.+.+||.|     ..|++.|.....|..|++.|  ..+|.|..  |+
T Consensus        38 ~~~~~~~~--~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C-----~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~--Cg  106 (128)
T PHA00733         38 QKRLIRAV--VKTLIYNPQLLDESSYLYKLLTSKAVSPYVC-----PLCLMPFSSSVSLKQHIRYT--EHSKVCPV--CG  106 (128)
T ss_pred             hhhHHHHH--HhhhccChhhhcchHHHHhhcccCCCCCccC-----CCCCCcCCCHHHHHHHHhcC--CcCccCCC--CC
Confidence            44566654  66555555444443  111   223455555     55666666666666666655  35799987  99


Q ss_pred             ccccChHHHHHHHHhhCCC
Q 026846           97 KAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        97 k~f~~~~~l~~H~~~~h~~  115 (232)
                      +.|.....|..|+...|+-
T Consensus       107 K~F~~~~sL~~H~~~~h~~  125 (128)
T PHA00733        107 KEFRNTDSTLDHVCKKHNI  125 (128)
T ss_pred             CccCCHHHHHHHHHHhcCc
Confidence            9999999999999988864


No 12 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=99.00  E-value=5.4e-10  Score=97.47  Aligned_cols=98  Identities=17%  Similarity=0.257  Sum_probs=73.7

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCC---------
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKT---------   71 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~---------   71 (232)
                      +|++.|. ...|..|+++|+  +|+.|+   |++.| .+..|..|+++|.+.+|+.|     ..|++.|..         
T Consensus       458 ~Cgk~f~-~s~LekH~~~~H--kpv~Cp---Cg~~~-~R~~L~~H~~thCp~Kpi~C-----~fC~~~v~~g~~~~d~~d  525 (567)
T PLN03086        458 KCGQAFQ-QGEMEKHMKVFH--EPLQCP---CGVVL-EKEQMVQHQASTCPLRLITC-----RFCGDMVQAGGSAMDVRD  525 (567)
T ss_pred             CCCCccc-hHHHHHHHHhcC--CCccCC---CCCCc-chhHHHhhhhccCCCCceeC-----CCCCCccccCccccchhh
Confidence            5888885 577888888874  788884   88655 56888888888888888888     567777741         


Q ss_pred             -CCCcccccccCCCCCCccCCcccccccccChHHHHHHHHhhCC
Q 026846           72 -PKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        72 -~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                       ...|..|..++ |.+++.|..  ||+.|..+ .|..|+...|.
T Consensus       526 ~~s~Lt~HE~~C-G~rt~~C~~--Cgk~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        526 RLRGMSEHESIC-GSRTAPCDS--CGRSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             hhhhHHHHHHhc-CCcceEccc--cCCeeeeh-hHHHHHHHhhc
Confidence             23677887775 888888876  88877765 57788777664


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.88  E-value=1.2e-09  Score=55.69  Aligned_cols=26  Identities=54%  Similarity=1.110  Sum_probs=23.5

Q ss_pred             HHHHHHHHhcCCCcccCCCCCCCccccc
Q 026846           11 NLRSHMKTHSQENYHICPYPDCGKRYAH   38 (232)
Q Consensus        11 ~L~~H~~~H~~~~p~~C~~~~C~~~f~~   38 (232)
                      +|.+||++|+|++||+|.+  |+++|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~--C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPY--CGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESS--SSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCC--CcCeeCc
Confidence            5899999999999999975  9999974


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.86  E-value=1.2e-09  Score=65.06  Aligned_cols=43  Identities=19%  Similarity=0.429  Sum_probs=36.3

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChH
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEY  103 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~  103 (232)
                      -|.|.  .||+.|.+..+|.+|+++|+                                   ++|+|..  |++.|.+.+
T Consensus         5 ~y~C~--~CGK~Fs~~~~L~~H~r~H~-----------------------------------k~~kc~~--C~k~f~~~s   45 (55)
T PHA02768          5 GYECP--ICGEIYIKRKSMITHLRKHN-----------------------------------TNLKLSN--CKRISLRTG   45 (55)
T ss_pred             ccCcc--hhCCeeccHHHHHHHHHhcC-----------------------------------CcccCCc--ccceecccc
Confidence            48996  59999999999999999993                                   5788865  999998776


Q ss_pred             HH
Q 026846          104 KL  105 (232)
Q Consensus       104 ~l  105 (232)
                      .|
T Consensus        46 ~l   47 (55)
T PHA02768         46 EY   47 (55)
T ss_pred             ee
Confidence            65


No 15 
>PHA02768 hypothetical protein; Provisional
Probab=98.70  E-value=8.1e-09  Score=61.52  Aligned_cols=39  Identities=8%  Similarity=0.137  Sum_probs=35.1

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHH
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLK   43 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~   43 (232)
                      .||+.|.+.++|..|+++|+  +||+|.  .|++.|.+++.|.
T Consensus        10 ~CGK~Fs~~~~L~~H~r~H~--k~~kc~--~C~k~f~~~s~l~   48 (55)
T PHA02768         10 ICGEIYIKRKSMITHLRKHN--TNLKLS--NCKRISLRTGEYI   48 (55)
T ss_pred             hhCCeeccHHHHHHHHHhcC--CcccCC--cccceecccceeE
Confidence            59999999999999999999  799996  6999999887664


No 16 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.64  E-value=2.9e-09  Score=54.26  Aligned_cols=23  Identities=35%  Similarity=0.957  Sum_probs=17.2

Q ss_pred             cccccCCCCCCccCCcccccccccC
Q 026846           77 GVYGSASSERPYACPYEGCEKAYIH  101 (232)
Q Consensus        77 ~H~~~H~~~k~~~C~~~~C~k~f~~  101 (232)
                      .|+++|+|+|||.|.+  |+++|.+
T Consensus         4 ~H~~~H~~~k~~~C~~--C~k~F~~   26 (26)
T PF13465_consen    4 RHMRTHTGEKPYKCPY--CGKSFSN   26 (26)
T ss_dssp             HHHHHHSSSSSEEESS--SSEEESS
T ss_pred             HHhhhcCCCCCCCCCC--CcCeeCc
Confidence            3444446789999988  9999974


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.61  E-value=2.6e-08  Score=87.09  Aligned_cols=76  Identities=14%  Similarity=0.220  Sum_probs=63.4

Q ss_pred             CcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccC-
Q 026846           23 NYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIH-  101 (232)
Q Consensus        23 ~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~-  101 (232)
                      +++.|.+  |++.|. ...|..|+++|+  +|+.|     + |++.+ .+..|..|+.+|...+|+.|.+  |++.|.. 
T Consensus       452 ~H~~C~~--Cgk~f~-~s~LekH~~~~H--kpv~C-----p-Cg~~~-~R~~L~~H~~thCp~Kpi~C~f--C~~~v~~g  517 (567)
T PLN03086        452 NHVHCEK--CGQAFQ-QGEMEKHMKVFH--EPLQC-----P-CGVVL-EKEQMVQHQASTCPLRLITCRF--CGDMVQAG  517 (567)
T ss_pred             cCccCCC--CCCccc-hHHHHHHHHhcC--CCccC-----C-CCCCc-chhHHHhhhhccCCCCceeCCC--CCCccccC
Confidence            4578975  999996 688999999985  78888     4 88654 6789999999999999999998  9999952 


Q ss_pred             ---------hHHHHHHHHhh
Q 026846          102 ---------EYKLKLHLKRE  112 (232)
Q Consensus       102 ---------~~~l~~H~~~~  112 (232)
                               ...|..|....
T Consensus       518 ~~~~d~~d~~s~Lt~HE~~C  537 (567)
T PLN03086        518 GSAMDVRDRLRGMSEHESIC  537 (567)
T ss_pred             ccccchhhhhhhHHHHHHhc
Confidence                     45799998774


No 18 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.58  E-value=4.8e-08  Score=80.90  Aligned_cols=112  Identities=19%  Similarity=0.309  Sum_probs=69.8

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccc-c
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGV-Y   79 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H-~   79 (232)
                      +|...|.....|.+|...-...--|+|.  +|+|.|+...||..|+|.|-.+..-.....   .-.+.-.....+..- .
T Consensus       272 LCK~kYeD~F~LAQHrC~RIV~vEYrCP--EC~KVFsCPANLASHRRWHKPR~eaa~a~~---~P~k~~~~~rae~~ea~  346 (500)
T KOG3993|consen  272 LCKEKYEDAFALAQHRCPRIVHVEYRCP--ECDKVFSCPANLASHRRWHKPRPEAAKAGS---PPPKQAVETRAEVQEAE  346 (500)
T ss_pred             HHHHhhhhHHHHhhccCCeeEEeeecCC--cccccccCchhhhhhhcccCCchhhhhcCC---CChhhhhhhhhhhhhcc
Confidence            4777788888899997644444569994  799999999999999998853321110000   000000000000000 0


Q ss_pred             cc--CCCCCCccCCcccccccccChHHHHHHHHhhCCCCCCC
Q 026846           80 GS--ASSERPYACPYEGCEKAYIHEYKLKLHLKREHPGHMSD  119 (232)
Q Consensus        80 ~~--H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~~~  119 (232)
                      |.  -....-|.|..  |+|.|.+...|++|+-+||......
T Consensus       347 rsg~dss~gi~~C~~--C~KkFrRqAYLrKHqlthq~~~~~k  386 (500)
T KOG3993|consen  347 RSGDDSSSGIFSCHT--CGKKFRRQAYLRKHQLTHQRAPLAK  386 (500)
T ss_pred             ccCCcccCceeecHH--hhhhhHHHHHHHHhHHhhhccccch
Confidence            00  01234799998  9999999999999999988765544


No 19 
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=98.49  E-value=1.1e-07  Score=78.75  Aligned_cols=113  Identities=20%  Similarity=0.368  Sum_probs=81.0

Q ss_pred             CccccCCChHHHHHHHHHhcC--------CC-------------------------cccCCCCCCCccccchhhHHHHHH
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQ--------EN-------------------------YHICPYPDCGKRYAHEYKLKNHIA   47 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~--------~~-------------------------p~~C~~~~C~~~f~~~~~l~~H~~   47 (232)
                      -|+|+|....+|..|.|+|..        ..                         .|.|.+  |+|.|.++..|+.|+.
T Consensus       300 EC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~--C~KkFrRqAYLrKHql  377 (500)
T KOG3993|consen  300 ECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHT--CGKKFRRQAYLRKHQL  377 (500)
T ss_pred             cccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHH--hhhhhHHHHHHHHhHH
Confidence            399999999999999999962        22                         289986  9999999999999999


Q ss_pred             HhcCCCC--------Cc---------c------------------------CCcCCCCCccccCCCCCcccccccCCCCC
Q 026846           48 SHHEKNA--------AV---------E------------------------VPRYATPPERITKTPKPPAGVYGSASSER   86 (232)
Q Consensus        48 ~h~~~~~--------~~---------c------------------------~~~~~~~c~~~~~~~~~l~~H~~~H~~~k   86 (232)
                      +|+....        +.         +                        ..-....++-.+..+..--.|.+.-....
T Consensus       378 thq~~~~~k~~a~~f~~s~~~~l~~~~~~~a~h~~a~~~~g~~vl~~a~sael~~pp~~~~ppsss~~sgg~~rlg~~~q  457 (500)
T KOG3993|consen  378 THQRAPLAKEKAPKFLLSRVIPLMHFNQAVATHSSASDSHGDEVLYVAGSAELELPPYDGSPPSSSGSSGGYGRLGIAEQ  457 (500)
T ss_pred             hhhccccchhcccCcchhhcccccccccccccccccccccccceeeeeccccccCCCCCCCCcccCCCCCccccccchhh
Confidence            9873211        10         0                        00111334444444444444554444566


Q ss_pred             CccCCcccccccccChHHHHHHHHhhCCCCC
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKREHPGHM  117 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~  117 (232)
                      .|.|.+  |.-+|..+.+|.+|+...|..+.
T Consensus       458 ~f~~ky--~~atfyss~~ltrhin~~Hpse~  486 (500)
T KOG3993|consen  458 GFTCKY--CPATFYSSPGLTRHINKCHPSEL  486 (500)
T ss_pred             cccccc--chHhhhcCcchHhHhhhcChHHh
Confidence            799999  99999999999999998887654


No 20 
>PHA00616 hypothetical protein
Probab=98.32  E-value=2.9e-07  Score=52.22  Aligned_cols=32  Identities=22%  Similarity=0.429  Sum_probs=27.2

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhcCCCCCcc
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVE   57 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c   57 (232)
                      ||+|.  .||+.|.++..|.+|++.|+|.+++.|
T Consensus         1 pYqC~--~CG~~F~~~s~l~~H~r~~hg~~~~~~   32 (44)
T PHA00616          1 MYQCL--RCGGIFRKKKEVIEHLLSVHKQNKLTL   32 (44)
T ss_pred             CCccc--hhhHHHhhHHHHHHHHHHhcCCCccce
Confidence            68995  699999999999999999987666544


No 21 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=98.31  E-value=3.3e-07  Score=73.36  Aligned_cols=73  Identities=27%  Similarity=0.544  Sum_probs=50.5

Q ss_pred             CCCcccCCCCCCCccccchhhHHHHHHH-hcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccc
Q 026846           21 QENYHICPYPDCGKRYAHEYKLKNHIAS-HHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAY   99 (232)
Q Consensus        21 ~~~p~~C~~~~C~~~f~~~~~l~~H~~~-h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f   99 (232)
                      ++|||+|+++.|.|+|+.+-.|+-|+.. |...+...-   -.+.--..|            -...|||.|.+  |+|.|
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~---p~p~~~~~F------------~~~~KPYrCev--C~KRY  408 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHEN---PSPEKMNIF------------SAKDKPYRCEV--CDKRY  408 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccccCcccCCC---CCccccccc------------cccCCceeccc--cchhh
Confidence            3599999999999999999999999874 211111000   001111112            12469999988  99999


Q ss_pred             cChHHHHHHHH
Q 026846          100 IHEYKLKLHLK  110 (232)
Q Consensus       100 ~~~~~l~~H~~  110 (232)
                      ...-.|+.|++
T Consensus       409 KNlNGLKYHr~  419 (423)
T COG5189         409 KNLNGLKYHRK  419 (423)
T ss_pred             ccCccceeccc
Confidence            99999999953


No 22 
>PHA00732 hypothetical protein
Probab=98.20  E-value=1.1e-06  Score=57.33  Aligned_cols=24  Identities=33%  Similarity=0.676  Sum_probs=21.3

Q ss_pred             cccCCCCCCCccccchhhHHHHHHH-h
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIAS-H   49 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~-h   49 (232)
                      ||.|..  |++.|.+..+|..|++. |
T Consensus         1 py~C~~--Cgk~F~s~s~Lk~H~r~~H   25 (79)
T PHA00732          1 MFKCPI--CGFTTVTLFALKQHARRNH   25 (79)
T ss_pred             CccCCC--CCCccCCHHHHHHHhhccc
Confidence            689975  99999999999999985 5


No 23 
>PHA00733 hypothetical protein
Probab=98.12  E-value=3.8e-06  Score=60.23  Aligned_cols=74  Identities=14%  Similarity=0.126  Sum_probs=57.0

Q ss_pred             ccccCCChHHHHHH--HH---HhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcc
Q 026846            2 KAVAFSLDFNLRSH--MK---THSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPA   76 (232)
Q Consensus         2 C~~~f~~~~~L~~H--~~---~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~   76 (232)
                      |.+.|.....|..|  ++   .+.+.+||.|..  |++.|.+...|..|++.|.  .+|.|     ..|++.|.....|.
T Consensus        46 ~~~~~~~~~~l~~~~~l~~~~~~~~~kPy~C~~--Cgk~Fss~s~L~~H~r~h~--~~~~C-----~~CgK~F~~~~sL~  116 (128)
T PHA00733         46 VKTLIYNPQLLDESSYLYKLLTSKAVSPYVCPL--CLMPFSSSVSLKQHIRYTE--HSKVC-----PVCGKEFRNTDSTL  116 (128)
T ss_pred             HhhhccChhhhcchHHHHhhcccCCCCCccCCC--CCCcCCCHHHHHHHHhcCC--cCccC-----CCCCCccCCHHHHH
Confidence            56666666555444  11   234588999974  9999999999999999763  46666     89999999999999


Q ss_pred             cccccCCC
Q 026846           77 GVYGSASS   84 (232)
Q Consensus        77 ~H~~~H~~   84 (232)
                      .|++...+
T Consensus       117 ~H~~~~h~  124 (128)
T PHA00733        117 DHVCKKHN  124 (128)
T ss_pred             HHHHHhcC
Confidence            99876543


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.07  E-value=8.8e-06  Score=49.19  Aligned_cols=53  Identities=34%  Similarity=0.646  Sum_probs=40.8

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChH
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEY  103 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~  103 (232)
                      .|.|+|  |++ ..+...|..|+...+.                               ...+.+.|++  |...+.  .
T Consensus         2 ~f~CP~--C~~-~~~~~~L~~H~~~~H~-------------------------------~~~~~v~CPi--C~~~~~--~   43 (54)
T PF05605_consen    2 SFTCPY--CGK-GFSESSLVEHCEDEHR-------------------------------SESKNVVCPI--CSSRVT--D   43 (54)
T ss_pred             CcCCCC--CCC-ccCHHHHHHHHHhHCc-------------------------------CCCCCccCCC--chhhhh--h
Confidence            489988  999 4556889999887642                               1245799988  998655  4


Q ss_pred             HHHHHHHhhCC
Q 026846          104 KLKLHLKREHP  114 (232)
Q Consensus       104 ~l~~H~~~~h~  114 (232)
                      +|..|++.+|+
T Consensus        44 ~l~~Hl~~~H~   54 (54)
T PF05605_consen   44 NLIRHLNSQHR   54 (54)
T ss_pred             HHHHHHHHhcC
Confidence            89999998774


No 25 
>PHA00616 hypothetical protein
Probab=97.91  E-value=5.8e-06  Score=46.95  Aligned_cols=27  Identities=22%  Similarity=0.397  Sum_probs=24.5

Q ss_pred             CccCCcccccccccChHHHHHHHHhhCCC
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~~h~~  115 (232)
                      ||.|..  ||+.|...+.|.+|+++||+.
T Consensus         1 pYqC~~--CG~~F~~~s~l~~H~r~~hg~   27 (44)
T PHA00616          1 MYQCLR--CGGIFRKKKEVIEHLLSVHKQ   27 (44)
T ss_pred             CCccch--hhHHHhhHHHHHHHHHHhcCC
Confidence            689977  999999999999999997765


No 26 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.80  E-value=1.4e-05  Score=39.16  Aligned_cols=23  Identities=39%  Similarity=0.905  Sum_probs=20.2

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHh
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASH   49 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h   49 (232)
                      |+|.+  |++.|.++..|..|++.|
T Consensus         1 y~C~~--C~~~f~~~~~l~~H~~~H   23 (23)
T PF00096_consen    1 YKCPI--CGKSFSSKSNLKRHMRRH   23 (23)
T ss_dssp             EEETT--TTEEESSHHHHHHHHHHH
T ss_pred             CCCCC--CCCccCCHHHHHHHHhHC
Confidence            68864  999999999999999875


No 27 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=97.75  E-value=1.9e-05  Score=38.74  Aligned_cols=22  Identities=41%  Similarity=0.987  Sum_probs=20.4

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |.|..  |++.|.+...|..|++.
T Consensus         1 y~C~~--C~~~f~~~~~l~~H~~~   22 (23)
T PF00096_consen    1 YKCPI--CGKSFSSKSNLKRHMRR   22 (23)
T ss_dssp             EEETT--TTEEESSHHHHHHHHHH
T ss_pred             CCCCC--CCCccCCHHHHHHHHhH
Confidence            67977  99999999999999987


No 28 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.73  E-value=2.6e-05  Score=38.42  Aligned_cols=24  Identities=29%  Similarity=0.890  Sum_probs=20.3

Q ss_pred             ccCCcccccccccChHHHHHHHHhhC
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKREH  113 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~~h  113 (232)
                      |.|.+  |++.|.+...|..|++++|
T Consensus         1 ~~C~~--C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPI--CGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SS--TS-EESSHHHHHHHHHHHS
T ss_pred             CCCcC--CCCcCCcHHHHHHHHHhhC
Confidence            68988  9999999999999999876


No 29 
>PHA00732 hypothetical protein
Probab=97.61  E-value=4.1e-05  Score=49.92  Aligned_cols=42  Identities=29%  Similarity=0.581  Sum_probs=35.0

Q ss_pred             CccccCCChHHHHHHHHH-hcCCCcccCCCCCCCccccchhhHHHHHHHhc
Q 026846            1 MKAVAFSLDFNLRSHMKT-HSQENYHICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~-H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      +|++.|.....|..|++. |.   ++.|..  |+++|.   .|..|++++.
T Consensus         6 ~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~--CgKsF~---~l~~H~~~~~   48 (79)
T PHA00732          6 ICGFTTVTLFALKQHARRNHT---LTKCPV--CNKSYR---RLNQHFYSQY   48 (79)
T ss_pred             CCCCccCCHHHHHHHhhcccC---CCccCC--CCCEeC---ChhhhhcccC
Confidence            599999999999999985 65   468974  999998   4888887653


No 30 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.58  E-value=3.9e-05  Score=39.20  Aligned_cols=26  Identities=23%  Similarity=0.553  Sum_probs=23.2

Q ss_pred             CccCCcccccccccChHHHHHHHHhhCC
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                      ||.|..  |++.|.....|..|++.|+.
T Consensus         1 ~~~C~~--C~~~F~~~~~l~~H~~~h~~   26 (27)
T PF13912_consen    1 PFECDE--CGKTFSSLSALREHKRSHCS   26 (27)
T ss_dssp             SEEETT--TTEEESSHHHHHHHHCTTTT
T ss_pred             CCCCCc--cCCccCChhHHHHHhHHhcC
Confidence            689987  99999999999999988654


No 31 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=97.49  E-value=2.7e-05  Score=66.97  Aligned_cols=115  Identities=29%  Similarity=0.381  Sum_probs=91.4

Q ss_pred             CccccCCChHHHHHHHH--HhcCC--CcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCC-----------------
Q 026846            1 MKAVAFSLDFNLRSHMK--THSQE--NYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVP-----------------   59 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~--~H~~~--~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~-----------------   59 (232)
                      .|...|.....|.+|.+  .|+++  +|+.|.+..|++.|.+...+.+|..+|++..++.+..                 
T Consensus       294 ~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  373 (467)
T COG5048         294 QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSKFSPLLNNEPPQ  373 (467)
T ss_pred             cccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccccccCccccccccCCCCcc
Confidence            47889999999999999  89999  9999984459999999999999999999877664311                 


Q ss_pred             ---------------cCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChHHHHHHHHhhCCC
Q 026846           60 ---------------RYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        60 ---------------~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~  115 (232)
                                     .....|...+.....+..|...|...+++.|....|.+.|.....+..|++.+...
T Consensus       374 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  444 (467)
T COG5048         374 SLQQYKDLKNDKKSETLSNSCIRNFKRDSNLSLHIITHLSFRPYNCKNPPCSKSFNRHYNLIPHKKIHTNH  444 (467)
T ss_pred             chhhccCccCCccccccccchhhhhccccccccccccccccCCcCCCCCcchhhccCcccccccccccccC
Confidence                           11133556677777788888888888876666667999999999999998774443


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.43  E-value=0.00011  Score=36.04  Aligned_cols=24  Identities=38%  Similarity=0.987  Sum_probs=19.3

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhc
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      |.|.+  |++.|.+...|..|++.|+
T Consensus         1 ~~C~~--C~~~~~~~~~l~~H~~~~H   24 (24)
T PF13894_consen    1 FQCPI--CGKSFRSKSELRQHMRTHH   24 (24)
T ss_dssp             EE-SS--TS-EESSHHHHHHHHHHHS
T ss_pred             CCCcC--CCCcCCcHHHHHHHHHhhC
Confidence            68976  9999999999999999873


No 33 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.43  E-value=9.3e-05  Score=50.44  Aligned_cols=73  Identities=18%  Similarity=0.491  Sum_probs=21.8

Q ss_pred             cCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChHHH
Q 026846           26 ICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKL  105 (232)
Q Consensus        26 ~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l  105 (232)
                      .|.+  |+..|.....|..|+...++...-         ....+.....+..+++.. -...+.|.+  |++.|.....|
T Consensus         1 ~C~~--C~~~f~~~~~l~~H~~~~H~~~~~---------~~~~l~~~~~~~~~~~~~-~~~~~~C~~--C~~~f~s~~~l   66 (100)
T PF12756_consen    1 QCLF--CDESFSSVDDLLQHMKKKHGFDIP---------DQKYLVDPNRLLNYLRKK-VKESFRCPY--CNKTFRSREAL   66 (100)
T ss_dssp             ------------------------------------------------------------SSEEBSS--SS-EESSHHHH
T ss_pred             Cccc--cccccccccccccccccccccccc---------cccccccccccccccccc-cCCCCCCCc--cCCCCcCHHHH
Confidence            3665  888888888888888765432110         000111111111222111 123799988  99999999999


Q ss_pred             HHHHHhh
Q 026846          106 KLHLKRE  112 (232)
Q Consensus       106 ~~H~~~~  112 (232)
                      ..|++.+
T Consensus        67 ~~Hm~~~   73 (100)
T PF12756_consen   67 QEHMRSK   73 (100)
T ss_dssp             HHHHHHT
T ss_pred             HHHHcCc
Confidence            9999975


No 34 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=97.39  E-value=0.00071  Score=53.15  Aligned_cols=27  Identities=22%  Similarity=0.418  Sum_probs=15.1

Q ss_pred             hcCCCcccCCCCCCCccccchhhHHHHHHH
Q 026846           19 HSQENYHICPYPDCGKRYAHEYKLKNHIAS   48 (232)
Q Consensus        19 H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~   48 (232)
                      .+|-|.|+|.|  |.. |.-...--.|+..
T Consensus       137 ~hGGrif~Csf--C~~-flCEDDQFEHQAs  163 (314)
T PF06524_consen  137 DHGGRIFKCSF--CDN-FLCEDDQFEHQAS  163 (314)
T ss_pred             cCCCeEEEeec--CCC-eeeccchhhhhhh
Confidence            34667788876  764 3334444445544


No 35 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=97.18  E-value=0.0008  Score=40.54  Aligned_cols=45  Identities=27%  Similarity=0.471  Sum_probs=34.9

Q ss_pred             CccccCCChHHHHHHHHH-hcCC-CcccCCCCCCCccccchhhHHHHHHHhc
Q 026846            1 MKAVAFSLDFNLRSHMKT-HSQE-NYHICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~-H~~~-~p~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      ||++. .....|..|... |..+ +.+.|++  |...+.  .+|.+|++.++
T Consensus         7 ~C~~~-~~~~~L~~H~~~~H~~~~~~v~CPi--C~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    7 YCGKG-FSESSLVEHCEDEHRSESKNVVCPI--CSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CCCCc-cCHHHHHHHHHhHCcCCCCCccCCC--chhhhh--hHHHHHHHHhc
Confidence            79994 556789999774 7654 5799976  998755  49999998864


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.13  E-value=0.00025  Score=36.10  Aligned_cols=25  Identities=32%  Similarity=0.561  Sum_probs=22.4

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhc
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      ||.|..  |++.|.+...|..|++.|.
T Consensus         1 ~~~C~~--C~~~F~~~~~l~~H~~~h~   25 (27)
T PF13912_consen    1 PFECDE--CGKTFSSLSALREHKRSHC   25 (27)
T ss_dssp             SEEETT--TTEEESSHHHHHHHHCTTT
T ss_pred             CCCCCc--cCCccCChhHHHHHhHHhc
Confidence            689975  9999999999999999874


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.03  E-value=0.00063  Score=39.57  Aligned_cols=40  Identities=25%  Similarity=0.476  Sum_probs=24.6

Q ss_pred             HHHHHH-hcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCC
Q 026846           13 RSHMKT-HSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNA   54 (232)
Q Consensus        13 ~~H~~~-H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~   54 (232)
                      ..+.+. +..+.|..|++  |+..+.+..+|++|+.++++.||
T Consensus        12 ~~~~k~~~~S~~PatCP~--C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   12 TKKPKSKSQSEQPATCPI--CGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             ----CCCCTTS--EE-TT--T--EESSHHHHHHHHHHHTTTS-
T ss_pred             hhHHHHhhccCCCCCCCc--chhhccchhhHHHHHHHHhcccC
Confidence            344443 34678999975  99999999999999999887665


No 38 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=96.80  E-value=0.0018  Score=37.72  Aligned_cols=31  Identities=32%  Similarity=0.585  Sum_probs=22.6

Q ss_pred             CCCCCccCCcccccccccChHHHHHHHHhhCCC
Q 026846           83 SSERPYACPYEGCEKAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        83 ~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~  115 (232)
                      ..+.|-.|+.  |+..+.+..+|++|+..+|..
T Consensus        20 ~S~~PatCP~--C~a~~~~srnLrRHle~~H~~   50 (54)
T PF09237_consen   20 QSEQPATCPI--CGAVIRQSRNLRRHLEIRHFK   50 (54)
T ss_dssp             TTS--EE-TT--T--EESSHHHHHHHHHHHTTT
T ss_pred             ccCCCCCCCc--chhhccchhhHHHHHHHHhcc
Confidence            3578999987  999999999999999988864


No 39 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.71  E-value=0.0015  Score=32.33  Aligned_cols=24  Identities=38%  Similarity=0.794  Sum_probs=20.9

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhc
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      |.|.+  |++.|.....|..|++.|.
T Consensus         1 ~~C~~--C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPE--CGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCC--CcchhCCHHHHHHHHHHhc
Confidence            57865  9999999999999999774


No 40 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=96.65  E-value=0.0013  Score=44.67  Aligned_cols=47  Identities=32%  Similarity=0.548  Sum_probs=19.2

Q ss_pred             CccccCCChHHHHHHHHH-hcC----------------------CCcccCCCCCCCccccchhhHHHHHHHh
Q 026846            1 MKAVAFSLDFNLRSHMKT-HSQ----------------------ENYHICPYPDCGKRYAHEYKLKNHIASH   49 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~-H~~----------------------~~p~~C~~~~C~~~f~~~~~l~~H~~~h   49 (232)
                      +|+..|.....|..||.. |.-                      ...+.|.+  |++.|.+...|..||+.+
T Consensus         4 ~C~~~f~~~~~l~~H~~~~H~~~~~~~~~l~~~~~~~~~~~~~~~~~~~C~~--C~~~f~s~~~l~~Hm~~~   73 (100)
T PF12756_consen    4 FCDESFSSVDDLLQHMKKKHGFDIPDQKYLVDPNRLLNYLRKKVKESFRCPY--CNKTFRSREALQEHMRSK   73 (100)
T ss_dssp             ---------------------------------------------SSEEBSS--SS-EESSHHHHHHHHHHT
T ss_pred             ccccccccccccccccccccccccccccccccccccccccccccCCCCCCCc--cCCCCcCHHHHHHHHcCc
Confidence            589999999999999864 431                      12478876  998898888899998875


No 41 
>smart00355 ZnF_C2H2 zinc finger.
Probab=96.58  E-value=0.0019  Score=31.96  Aligned_cols=22  Identities=36%  Similarity=0.833  Sum_probs=19.8

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |.|..  |+++|.....|..|++.
T Consensus         1 ~~C~~--C~~~f~~~~~l~~H~~~   22 (26)
T smart00355        1 YRCPE--CGKVFKSKSALKEHMRT   22 (26)
T ss_pred             CCCCC--CcchhCCHHHHHHHHHH
Confidence            57877  99999999999999985


No 42 
>KOG4377 consensus Zn-finger protein [General function prediction only]
Probab=96.56  E-value=0.0054  Score=51.37  Aligned_cols=106  Identities=16%  Similarity=0.176  Sum_probs=71.7

Q ss_pred             CccccCCChHHHHHHHHHhcCC------------CcccCCCCCCCccccchhhHHHHHHHhcCCCCC--------ccCCc
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQE------------NYHICPYPDCGKRYAHEYKLKNHIASHHEKNAA--------VEVPR   60 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~------------~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~--------~c~~~   60 (232)
                      +|+..+..+..+.+|..+|.-.            ..|-|.+..|.|   +.++...|-..|+. +++        -|.. 
T Consensus       278 ~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~-~~n~GfrrthfhC~r-  352 (480)
T KOG4377|consen  278 YCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTD-KRNNGFRRTHFHCQR-  352 (480)
T ss_pred             cccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccc-cccCceecceeEEec-
Confidence            5887777799999999998632            236888888988   55667777777743 333        2322 


Q ss_pred             CCCCCccccCCCCCcccccccCCCC------------------------CCccCCcccccccccChHHHHHHHHhhC
Q 026846           61 YATPPERITKTPKPPAGVYGSASSE------------------------RPYACPYEGCEKAYIHEYKLKLHLKREH  113 (232)
Q Consensus        61 ~~~~c~~~~~~~~~l~~H~~~H~~~------------------------k~~~C~~~~C~k~f~~~~~l~~H~~~~h  113 (232)
                        ..|.-.|+...+-..|++-+.++                        .-|.|...||+.+|...++|..|.|.|-
T Consensus       353 --~gCTdtfK~~khk~yh~kdda~~~dGfkkf~k~e~cay~gCkys~~cnhfhc~r~Gc~~tl~s~sqm~shkrkhe  427 (480)
T KOG4377|consen  353 --IGCTDTFKDSKHKPYHYKDDAGEIDGFKKFFKDENCAYTGCKYSGICNHFHCDRLGCEATLYSVSQMASHKRKHE  427 (480)
T ss_pred             --cCCccccccccccccccCcchhhhhhhhhhhccccCCccCcccccceeeeeecccCCceEEEehhhhhhhhhhhh
Confidence              23556666555555555544322                        1355888899999999999999987743


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.52  E-value=0.0017  Score=31.92  Aligned_cols=24  Identities=50%  Similarity=0.948  Sum_probs=19.1

Q ss_pred             ccCCcccccccccChHHHHHHHHhhCC
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                      |+|..  |+.+.. ...|.+|++++|+
T Consensus         1 y~C~~--C~y~t~-~~~l~~H~~~~H~   24 (24)
T PF13909_consen    1 YKCPH--CSYSTS-KSNLKRHLKRHHP   24 (24)
T ss_dssp             EE-SS--SS-EES-HHHHHHHHHHHHS
T ss_pred             CCCCC--CCCcCC-HHHHHHHHHhhCc
Confidence            68987  998888 8899999999874


No 44 
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=95.99  E-value=0.0011  Score=50.21  Aligned_cols=86  Identities=17%  Similarity=0.220  Sum_probs=68.7

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCccccccc-C---------CCCCCccCC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGS-A---------SSERPYACP   91 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~-H---------~~~k~~~C~   91 (232)
                      .+.|.|++..|...|........|-.+-++        ..|..|.+.|.+...|-.|+.- |         .|.-.|.|-
T Consensus        77 ~~~~~cqvagc~~~~d~lD~~E~hY~~~h~--------~sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~Cl  148 (253)
T KOG4173|consen   77 VPAFACQVAGCCQVFDALDDYEHHYHTLHG--------NSCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCL  148 (253)
T ss_pred             cccccccccchHHHHhhhhhHHHhhhhccc--------chhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHH
Confidence            356889999999999988877777544332        2347899999999999998652 3         467789999


Q ss_pred             cccccccccChHHHHHHHHhhCCC
Q 026846           92 YEGCEKAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        92 ~~~C~k~f~~~~~l~~H~~~~h~~  115 (232)
                      ++||+-.|.+....+.|+-..|..
T Consensus       149 vEgCt~KFkT~r~RkdH~I~~Hk~  172 (253)
T KOG4173|consen  149 VEGCTEKFKTSRDRKDHMIRMHKY  172 (253)
T ss_pred             HHhhhhhhhhhhhhhhHHHHhccC
Confidence            999999999999999998877764


No 45 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=95.92  E-value=0.0088  Score=47.18  Aligned_cols=18  Identities=28%  Similarity=0.637  Sum_probs=8.6

Q ss_pred             CCccCCcccccccccChHHH
Q 026846           86 RPYACPYEGCEKAYIHEYKL  105 (232)
Q Consensus        86 k~~~C~~~~C~k~f~~~~~l  105 (232)
                      +++.|+-  ||.-......|
T Consensus       208 k~~PCPK--Cg~et~eTkdL  225 (314)
T PF06524_consen  208 KPIPCPK--CGYETQETKDL  225 (314)
T ss_pred             CCCCCCC--CCCcccccccc
Confidence            4555544  55444443333


No 46 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=95.92  E-value=0.0073  Score=29.62  Aligned_cols=23  Identities=35%  Similarity=0.713  Sum_probs=17.9

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhc
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      |+|.+  |..... +..|.+|++.|+
T Consensus         1 y~C~~--C~y~t~-~~~l~~H~~~~H   23 (24)
T PF13909_consen    1 YKCPH--CSYSTS-KSNLKRHLKRHH   23 (24)
T ss_dssp             EE-SS--SS-EES-HHHHHHHHHHHH
T ss_pred             CCCCC--CCCcCC-HHHHHHHHHhhC
Confidence            68975  999988 889999999875


No 47 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.84  E-value=0.0056  Score=30.32  Aligned_cols=23  Identities=30%  Similarity=0.738  Sum_probs=20.2

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHh
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASH   49 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h   49 (232)
                      |.|.+  |++.|.+...|..|++.+
T Consensus         1 ~~C~~--C~~~f~s~~~~~~H~~s~   23 (25)
T PF12874_consen    1 FYCDI--CNKSFSSENSLRQHLRSK   23 (25)
T ss_dssp             EEETT--TTEEESSHHHHHHHHTTH
T ss_pred             CCCCC--CCCCcCCHHHHHHHHCcC
Confidence            67876  999999999999999875


No 48 
>PRK04860 hypothetical protein; Provisional
Probab=95.73  E-value=0.0059  Score=45.45  Aligned_cols=30  Identities=13%  Similarity=0.256  Sum_probs=23.2

Q ss_pred             CCCCcccccccCCCCCCccCCcccccccccCh
Q 026846           71 TPKPPAGVYGSASSERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        71 ~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~  102 (232)
                      ....+..|.++|+++++|.|..  |+..|...
T Consensus       127 ~~~~~rrH~ri~~g~~~YrC~~--C~~~l~~~  156 (160)
T PRK04860        127 HQLTVRRHNRVVRGEAVYRCRR--CGETLVFK  156 (160)
T ss_pred             eeCHHHHHHHHhcCCccEECCC--CCceeEEe
Confidence            4455667777778899999987  99988754


No 49 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=95.65  E-value=0.0075  Score=29.83  Aligned_cols=22  Identities=32%  Similarity=0.798  Sum_probs=19.9

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |.|.+  |++.|.....|..|++.
T Consensus         1 ~~C~~--C~~~f~s~~~~~~H~~s   22 (25)
T PF12874_consen    1 FYCDI--CNKSFSSENSLRQHLRS   22 (25)
T ss_dssp             EEETT--TTEEESSHHHHHHHHTT
T ss_pred             CCCCC--CCCCcCCHHHHHHHHCc
Confidence            67887  99999999999999875


No 50 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=95.01  E-value=0.016  Score=49.76  Aligned_cols=77  Identities=8%  Similarity=-0.012  Sum_probs=60.9

Q ss_pred             CcccCCCCCCCccccchhhHHHHHH--HhcCC--CCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCccccccc
Q 026846           23 NYHICPYPDCGKRYAHEYKLKNHIA--SHHEK--NAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKA   98 (232)
Q Consensus        23 ~p~~C~~~~C~~~f~~~~~l~~H~~--~h~~~--~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~   98 (232)
                      .++.|.  .|...|.....|.+|.+  .|.+.  +|+.|...   .|++.|.....+..|..+|.+.+++.|....|.+.
T Consensus       288 ~~~~~~--~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~---~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  362 (467)
T COG5048         288 LPIKSK--QCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYS---LCGKLFSRNDALKRHILLHTSISPAKEKLLNSSSK  362 (467)
T ss_pred             cCCCCc--cccCCccccccccccccccccccccCCceeeecc---CCCccccccccccCCcccccCCCccccccccCccc
Confidence            467775  48899999999999998  78888  88888433   78888888888888988888888888877667666


Q ss_pred             ccChHH
Q 026846           99 YIHEYK  104 (232)
Q Consensus        99 f~~~~~  104 (232)
                      +.....
T Consensus       363 ~~~~~~  368 (467)
T COG5048         363 FSPLLN  368 (467)
T ss_pred             cccccC
Confidence            665544


No 51 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=94.84  E-value=0.0099  Score=56.81  Aligned_cols=88  Identities=22%  Similarity=0.336  Sum_probs=60.0

Q ss_pred             ccCCChHHHHHHHH-HhcCCCcccCCCCCCCccccchhhHHHHHHHhcCC--CCCccCCcCCCCCccccCCCCCcccccc
Q 026846            4 VAFSLDFNLRSHMK-THSQENYHICPYPDCGKRYAHEYKLKNHIASHHEK--NAAVEVPRYATPPERITKTPKPPAGVYG   80 (232)
Q Consensus         4 ~~f~~~~~L~~H~~-~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~--~~~~c~~~~~~~c~~~~~~~~~l~~H~~   80 (232)
                      ..|.++..|.-|+. +|+-.+-|+|+  .|++.|.....|-.|||.-+..  -.|+.                +...|.+
T Consensus       444 ~~~~s~r~~~~~t~~L~S~~kt~~cp--kc~~~yk~a~~L~vhmRskhp~~~~~~c~----------------~gq~~~~  505 (1406)
T KOG1146|consen  444 PLLESKRSLEGQTVVLHSFFKTLKCP--KCNWHYKLAQTLGVHMRSKHPESQSAYCK----------------AGQNHPR  505 (1406)
T ss_pred             hhhhhhcccccceeeeecccccccCC--ccchhhhhHHHhhhcccccccccchhHhH----------------hcccccc
Confidence            34444555555554 47777899996  6999999999999999984321  11111                0111111


Q ss_pred             c------CCCCCCccCCcccccccccChHHHHHHHHh
Q 026846           81 S------ASSERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        81 ~------H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      .      -.+.+||.|..  |..+|....+|..|++.
T Consensus       506 ~arg~~~~~~~~p~~C~~--C~~stttng~LsihlqS  540 (1406)
T KOG1146|consen  506 LARGEVYRCPGKPYPCRA--CNYSTTTNGNLSIHLQS  540 (1406)
T ss_pred             ccccccccCCCCccccee--eeeeeecchHHHHHHHH
Confidence            1      12568999988  99999999999999875


No 52 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.83  E-value=0.01  Score=30.07  Aligned_cols=22  Identities=36%  Similarity=0.771  Sum_probs=19.5

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |.|..  |++.|.....|..|+++
T Consensus         2 ~~C~~--C~k~f~~~~~~~~H~~s   23 (27)
T PF12171_consen    2 FYCDA--CDKYFSSENQLKQHMKS   23 (27)
T ss_dssp             CBBTT--TTBBBSSHHHHHCCTTS
T ss_pred             CCccc--CCCCcCCHHHHHHHHcc
Confidence            67877  99999999999999875


No 53 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.81  E-value=0.052  Score=37.60  Aligned_cols=17  Identities=29%  Similarity=0.815  Sum_probs=11.5

Q ss_pred             CCCCccCCcccccccccCh
Q 026846           84 SERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~  102 (232)
                      +..|-.|++  ||..|.-.
T Consensus        23 nk~PivCP~--CG~~~~~~   39 (108)
T PF09538_consen   23 NKDPIVCPK--CGTEFPPE   39 (108)
T ss_pred             CCCCccCCC--CCCccCcc
Confidence            346777877  88777654


No 54 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=94.15  E-value=0.035  Score=45.19  Aligned_cols=30  Identities=43%  Similarity=0.961  Sum_probs=26.4

Q ss_pred             CCCCccCCcccccccccChHHHHHHHHhhC
Q 026846           84 SERPYACPYEGCEKAYIHEYKLKLHLKREH  113 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h  113 (232)
                      ++|||+|++++|.|+|...-.|+.|+.--|
T Consensus       346 d~KpykCpV~gC~K~YknqnGLKYH~lhGH  375 (423)
T COG5189         346 DGKPYKCPVEGCNKKYKNQNGLKYHMLHGH  375 (423)
T ss_pred             cCceecCCCCCchhhhccccchhhhhhccc
Confidence            469999999999999999999999976434


No 55 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=94.15  E-value=0.016  Score=29.33  Aligned_cols=23  Identities=35%  Similarity=0.714  Sum_probs=19.2

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHh
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASH   49 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h   49 (232)
                      |.|.+  |++.|.+...|..|+++.
T Consensus         2 ~~C~~--C~k~f~~~~~~~~H~~sk   24 (27)
T PF12171_consen    2 FYCDA--CDKYFSSENQLKQHMKSK   24 (27)
T ss_dssp             CBBTT--TTBBBSSHHHHHCCTTSH
T ss_pred             CCccc--CCCCcCCHHHHHHHHccC
Confidence            67875  999999999999988753


No 56 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=93.29  E-value=0.59  Score=38.75  Aligned_cols=95  Identities=20%  Similarity=0.349  Sum_probs=58.7

Q ss_pred             ChHHHHHHHHHh---cCCCcc-cCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccc-------cCCCCCcc
Q 026846            8 LDFNLRSHMKTH---SQENYH-ICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERI-------TKTPKPPA   76 (232)
Q Consensus         8 ~~~~L~~H~~~H---~~~~p~-~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~-------~~~~~~l~   76 (232)
                      ++..|+.|...-   .|-+-+ .|.+  |...|..-..|.+|+|..+..         |.+|.++       |+.-..|.
T Consensus       200 ~~~~Lr~H~~~G~~e~GFKGHP~C~F--C~~~FYdDDEL~~HcR~~HE~---------ChICD~v~p~~~QYFK~Y~~Le  268 (493)
T COG5236         200 RSSTLRDHKNGGLEEEGFKGHPLCIF--CKIYFYDDDELRRHCRLRHEA---------CHICDMVGPIRYQYFKSYEDLE  268 (493)
T ss_pred             ecccccccccCCccccCcCCCchhhh--ccceecChHHHHHHHHhhhhh---------hhhhhccCccchhhhhCHHHHH
Confidence            456677776542   233333 4876  999999999999999986532         2344443       33333344


Q ss_pred             cccccCCCCCCccCCccccc----ccccChHHHHHHHHhhCCCCC
Q 026846           77 GVYGSASSERPYACPYEGCE----KAYIHEYKLKLHLKREHPGHM  117 (232)
Q Consensus        77 ~H~~~H~~~k~~~C~~~~C~----k~f~~~~~l~~H~~~~h~~~~  117 (232)
                      .|.+    .--|.|.+-.|-    .+|.....|..|+...|....
T Consensus       269 ~HF~----~~hy~ct~qtc~~~k~~vf~~~~el~~h~~~~h~~~~  309 (493)
T COG5236         269 AHFR----NAHYCCTFQTCRVGKCYVFPYHTELLEHLTRFHKVNA  309 (493)
T ss_pred             HHhh----cCceEEEEEEEecCcEEEeccHHHHHHHHHHHhhccc
Confidence            4433    223666654452    468899999999988776544


No 57 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.12  E-value=0.049  Score=32.31  Aligned_cols=33  Identities=18%  Similarity=0.371  Sum_probs=28.4

Q ss_pred             cCCCCCCccCCcccccccccChHHHHHHHHhhCCC
Q 026846           81 SASSERPYACPYEGCEKAYIHEYKLKLHLKREHPG  115 (232)
Q Consensus        81 ~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~  115 (232)
                      .-.|+-.+.|+.  ||..|..+....+|+...|.-
T Consensus        11 ~RDGE~~lrCPR--C~~~FR~~K~Y~RHVNKaH~~   43 (65)
T COG4049          11 DRDGEEFLRCPR--CGMVFRRRKDYIRHVNKAHGW   43 (65)
T ss_pred             ccCCceeeeCCc--hhHHHHHhHHHHHHhhHHhhh
Confidence            346788999988  999999999999999887754


No 58 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=93.04  E-value=0.09  Score=26.09  Aligned_cols=21  Identities=29%  Similarity=0.689  Sum_probs=16.9

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      ..|..  ||+.| ....|.+|++.
T Consensus         3 ~~C~~--CgR~F-~~~~l~~H~~~   23 (25)
T PF13913_consen    3 VPCPI--CGRKF-NPDRLEKHEKI   23 (25)
T ss_pred             CcCCC--CCCEE-CHHHHHHHHHh
Confidence            46877  99999 56789999764


No 59 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.82  E-value=0.13  Score=27.52  Aligned_cols=23  Identities=26%  Similarity=0.658  Sum_probs=20.4

Q ss_pred             CccCCcccccccccChHHHHHHHHh
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      +|.|.+  |++.|.....+..|++.
T Consensus         3 ~~~C~~--C~~~~~~~~~~~~H~~g   25 (35)
T smart00451        3 GFYCKL--CNVTFTDEISVEAHLKG   25 (35)
T ss_pred             CeEccc--cCCccCCHHHHHHHHCh
Confidence            588988  99999999999999875


No 60 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=91.30  E-value=0.17  Score=27.05  Aligned_cols=24  Identities=17%  Similarity=0.519  Sum_probs=20.9

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHh
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASH   49 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h   49 (232)
                      +|.|.+  |++.|.....+..|++..
T Consensus         3 ~~~C~~--C~~~~~~~~~~~~H~~gk   26 (35)
T smart00451        3 GFYCKL--CNVTFTDEISVEAHLKGK   26 (35)
T ss_pred             CeEccc--cCCccCCHHHHHHHHChH
Confidence            588986  999999999999998764


No 61 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=91.16  E-value=0.057  Score=44.53  Aligned_cols=72  Identities=32%  Similarity=0.562  Sum_probs=46.0

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIH  101 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~  101 (232)
                      .+||+|.+|+|.+.+.....|+.|...-+              |..+........-|.---...|||.|.+  |.+.+.-
T Consensus       347 ~~~~~~~vp~~~~~~~n~ng~~~~~~~~h--------------~s~i~~~s~~~~ph~~~~~~nk~~r~~i--~~~~~k~  410 (442)
T KOG4124|consen  347 DKPYKCPVPNCDKAYKNQNGLKYHKLHGH--------------CSPITTPTPAPIPHQGFVVENKPYRCEV--CSKRYKN  410 (442)
T ss_pred             cCCCCCCCCcchhhcccCcceeeccccCc--------------CCCCCCCCCCCCCcceeeeccCcccChh--hhhhhcc
Confidence            57899999999999999888887754311              1111111111111111112368999988  9999887


Q ss_pred             hHHHHHHH
Q 026846          102 EYKLKLHL  109 (232)
Q Consensus       102 ~~~l~~H~  109 (232)
                      ...|+.|+
T Consensus       411 ~~~l~~~~  418 (442)
T KOG4124|consen  411 LNGLKYHR  418 (442)
T ss_pred             CCCCCcee
Confidence            77777774


No 62 
>KOG1146 consensus Homeobox protein [General function prediction only]
Probab=90.95  E-value=0.34  Score=46.91  Aligned_cols=75  Identities=13%  Similarity=0.121  Sum_probs=58.4

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIH  101 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~  101 (232)
                      .++|.|..  |...|.....|..|.+.                |-+.++....+.-|+..|..-++| |..  |...|..
T Consensus      1282 ~~~~~~~~--~~~~~~~~~~l~~~~~k----------------~~~~~~~~~~~~~~~l~~~d~~~~-c~~--c~~~~~~ 1340 (1406)
T KOG1146|consen 1282 THRYLCRQ--CKMAFDGEAPLTAHQRK----------------FCFAGRGSGGSMPPPLRVPDCTYH-CLA--CEVLLSG 1340 (1406)
T ss_pred             chhHHHHH--HHhhhcchhHHHHHHHH----------------HHhccCccccCCCCcccCcccccc-chH--HHhhcch
Confidence            45789975  99999999999998832                224455566666677777777888 988  9999999


Q ss_pred             hHHHHHHHHhhCCCCC
Q 026846          102 EYKLKLHLKREHPGHM  117 (232)
Q Consensus       102 ~~~l~~H~~~~h~~~~  117 (232)
                      ...|..|+++.+...+
T Consensus      1341 ~~alqihm~~~~~~~k 1356 (1406)
T KOG1146|consen 1341 REALQIHMRSSAHRRK 1356 (1406)
T ss_pred             hHHHHHHHHHhhhccc
Confidence            9999999998665544


No 63 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=89.27  E-value=0.11  Score=40.74  Aligned_cols=40  Identities=23%  Similarity=0.220  Sum_probs=31.2

Q ss_pred             CccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHH
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHI   46 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~   46 (232)
                      ||++.|.....|.+|++.    |-|+|.+  |.|.+.+-..|..|.
T Consensus        15 ycnrefddekiliqhqka----khfkchi--chkkl~sgpglsihc   54 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQKA----KHFKCHI--CHKKLFSGPGLSIHC   54 (341)
T ss_pred             ecccccchhhhhhhhhhh----ccceeee--ehhhhccCCCceeeh
Confidence            788888888888888774    3488886  888877777777763


No 64 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.77  E-value=0.95  Score=32.04  Aligned_cols=20  Identities=30%  Similarity=0.544  Sum_probs=14.3

Q ss_pred             CCCCccCCcccccccccChHHH
Q 026846           84 SERPYACPYEGCEKAYIHEYKL  105 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l  105 (232)
                      +..|-.|++  ||..|.....+
T Consensus        23 nk~p~vcP~--cg~~~~~~~~~   42 (129)
T TIGR02300        23 NRRPAVSPY--TGEQFPPEEAL   42 (129)
T ss_pred             CCCCccCCC--cCCccCcchhh
Confidence            457888988  99888665333


No 65 
>KOG2893 consensus Zn finger protein [General function prediction only]
Probab=88.48  E-value=0.13  Score=40.26  Aligned_cols=51  Identities=24%  Similarity=0.539  Sum_probs=35.4

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIH  101 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~  101 (232)
                      .||| |-|  |++-|....-|..|++.                                     |-|+|.+  |.|...+
T Consensus         9 ~kpw-cwy--cnrefddekiliqhqka-------------------------------------khfkchi--chkkl~s   46 (341)
T KOG2893|consen    9 DKPW-CWY--CNREFDDEKILIQHQKA-------------------------------------KHFKCHI--CHKKLFS   46 (341)
T ss_pred             CCce-eee--cccccchhhhhhhhhhh-------------------------------------ccceeee--ehhhhcc
Confidence            4666 445  99999999999988874                                     3377877  8776666


Q ss_pred             hHHHHHHHHhhCC
Q 026846          102 EYKLKLHLKREHP  114 (232)
Q Consensus       102 ~~~l~~H~~~~h~  114 (232)
                      ...|..|--.+|.
T Consensus        47 gpglsihcmqvhk   59 (341)
T KOG2893|consen   47 GPGLSIHCMQVHK   59 (341)
T ss_pred             CCCceeehhhhhh
Confidence            6666666444443


No 66 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=88.30  E-value=0.88  Score=41.43  Aligned_cols=93  Identities=18%  Similarity=0.339  Sum_probs=46.8

Q ss_pred             ChHHHHHHHHHhc-CCCc----ccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcC-CCCCccccCCCCCccccccc
Q 026846            8 LDFNLRSHMKTHS-QENY----HICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRY-ATPPERITKTPKPPAGVYGS   81 (232)
Q Consensus         8 ~~~~L~~H~~~H~-~~~p----~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~-~~~c~~~~~~~~~l~~H~~~   81 (232)
                      ++..|.+|++.-- +++-    -.|.+  |...|.....|.+|++.++.    .|.++. ...++.-|.....|..|.+.
T Consensus       161 t~~el~~h~~~gd~d~~s~rGhp~C~~--C~~~fld~~el~rH~~~~h~----~chfC~~~~~~neyy~~~~dLe~HfR~  234 (669)
T KOG2231|consen  161 TRAELNLHLMFGDPDDESCRGHPLCKF--CHERFLDDDELYRHLRFDHE----FCHFCDYKTGQNEYYNDYDDLEEHFRK  234 (669)
T ss_pred             hHHHHHHHHhcCCCccccccCCccchh--hhhhhccHHHHHHhhcccee----heeecCcccccchhcccchHHHHHhhh
Confidence            4556667766421 1221    24655  88888888888888887642    221111 23334444555556666554


Q ss_pred             CCCCCCccCCcccc-cccccChHHHHHHHH
Q 026846           82 ASSERPYACPYEGC-EKAYIHEYKLKLHLK  110 (232)
Q Consensus        82 H~~~k~~~C~~~~C-~k~f~~~~~l~~H~~  110 (232)
                      +.    |.|...-| .+.|.....+..|++
T Consensus       235 ~H----flCE~~~C~~~~f~~~~~~ei~lk  260 (669)
T KOG2231|consen  235 GH----FLCEEEFCRTKKFYVAFELEIELK  260 (669)
T ss_pred             cC----ccccccccccceeeehhHHHHHHH
Confidence            33    44542224 233444434444444


No 67 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.14  E-value=0.3  Score=27.78  Aligned_cols=28  Identities=36%  Similarity=0.668  Sum_probs=18.6

Q ss_pred             CCCCccCCcccccccccCh----HHHHHHHHhhC
Q 026846           84 SERPYACPYEGCEKAYIHE----YKLKLHLKREH  113 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~----~~l~~H~~~~h  113 (232)
                      +.....|.+  |++.+...    ++|.+|++..|
T Consensus        13 ~~~~a~C~~--C~~~~~~~~~~ts~l~~HL~~~h   44 (45)
T PF02892_consen   13 DKKKAKCKY--CGKVIKYSSGGTSNLKRHLKKKH   44 (45)
T ss_dssp             CSS-EEETT--TTEE-----SSTHHHHHHHHHTT
T ss_pred             CcCeEEeCC--CCeEEeeCCCcHHHHHHhhhhhC
Confidence            355678988  99998874    78999997655


No 68 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=87.23  E-value=0.89  Score=38.26  Aligned_cols=81  Identities=16%  Similarity=0.232  Sum_probs=45.6

Q ss_pred             cccCCCCCCCccccchhhHHHHHHH--hc---CCCCCccCCcCCCCCccccCCCCCccc---ccccCCCCCCccCCcccc
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIAS--HH---EKNAAVEVPRYATPPERITKTPKPPAG---VYGSASSERPYACPYEGC   95 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~--h~---~~~~~~c~~~~~~~c~~~~~~~~~l~~---H~~~H~~~k~~~C~~~~C   95 (232)
                      -|.|.  .|...|.....-+.|.++  |.   ..+-..-.    ++.--.|..+..-..   -...-.+.-++.|.+  |
T Consensus         3 ~ftC~--tC~v~F~~ad~Qr~HyKSdWHRYNLKRkVA~lP----PItaE~F~~k~~s~~~~~~~~~e~~~~~~~c~~--c   74 (390)
T KOG2785|consen    3 GFTCN--TCNVEFDDADEQRAHYKSDWHRYNLKRKVASLP----PITAEEFNEKVLSDDSEKEENLEEAESVVYCEA--C   74 (390)
T ss_pred             cceee--ceeeeeccHHHHHHHhhhhHHHhhHHhHhhcCC----CcCHHHHhHHHhhhhhhhhhhhhhcccceehHH--h
Confidence            37885  699999999888888886  32   11111100    000000100000000   000112456899988  9


Q ss_pred             cccccChHHHHHHHHhh
Q 026846           96 EKAYIHEYKLKLHLKRE  112 (232)
Q Consensus        96 ~k~f~~~~~l~~H~~~~  112 (232)
                      .|.|........|++..
T Consensus        75 ~k~~~s~~a~~~hl~Sk   91 (390)
T KOG2785|consen   75 NKSFASPKAHENHLKSK   91 (390)
T ss_pred             hccccChhhHHHHHHHh
Confidence            99999999999998863


No 69 
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=84.96  E-value=1.1  Score=37.31  Aligned_cols=89  Identities=17%  Similarity=0.254  Sum_probs=51.3

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhcCCCCC-ccCCcCC-CCCccccCCCCCcccccccCCCCCCc----cCCccccccc
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHHEKNAA-VEVPRYA-TPPERITKTPKPPAGVYGSASSERPY----ACPYEGCEKA   98 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~-~c~~~~~-~~c~~~~~~~~~l~~H~~~H~~~k~~----~C~~~~C~k~   98 (232)
                      |.|+...|..+....-.|+.|.+..++.--. .|...+. -.|....-+...|+.|...-..+..|    .|.+  |.+.
T Consensus       152 F~CP~skc~~~C~~~k~lk~H~K~~H~~~~C~~C~~nKk~F~~E~~lF~~~~Lr~H~~~G~~e~GFKGHP~C~F--C~~~  229 (493)
T COG5236         152 FKCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEIRLFRSSTLRDHKNGGLEEEGFKGHPLCIF--CKIY  229 (493)
T ss_pred             hcCCchhhhhhhhhHHHHHHHHHhhcCcEEhHhhhcCcccCccceeeeecccccccccCCccccCcCCCchhhh--ccce
Confidence            7777666777777777888888875542110 1211111 11222233445566665543323222    3777  8888


Q ss_pred             ccChHHHHHHHHhhCCC
Q 026846           99 YIHEYKLKLHLKREHPG  115 (232)
Q Consensus        99 f~~~~~l~~H~~~~h~~  115 (232)
                      |..-..|.+|+|..|..
T Consensus       230 FYdDDEL~~HcR~~HE~  246 (493)
T COG5236         230 FYDDDELRRHCRLRHEA  246 (493)
T ss_pred             ecChHHHHHHHHhhhhh
Confidence            88888888888876643


No 70 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=84.45  E-value=0.67  Score=42.37  Aligned_cols=10  Identities=10%  Similarity=0.056  Sum_probs=4.8

Q ss_pred             hhHHHHHHHh
Q 026846           40 YKLKNHIASH   49 (232)
Q Consensus        40 ~~l~~H~~~h   49 (232)
                      ..|.++...+
T Consensus        39 ~el~~~~~~~   48 (622)
T PF02724_consen   39 SELERAYEEL   48 (622)
T ss_pred             HHHHHHHHHH
Confidence            4455554444


No 71 
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=84.30  E-value=3.9  Score=30.23  Aligned_cols=56  Identities=16%  Similarity=0.131  Sum_probs=36.9

Q ss_pred             CCCCccccCCCCCcccccccCCCCCCccCCcccccccccChHHHHHHHHhhCCCCCCC
Q 026846           62 ATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKREHPGHMSD  119 (232)
Q Consensus        62 ~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~~~  119 (232)
                      |++|+.......... --|.+...|+-.|..++|..+ .+...|++|.|..|+...|.
T Consensus        83 CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~F~-GtY~eLrKHar~~HP~~rP~  138 (162)
T PF07800_consen   83 CPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCSFS-GTYSELRKHARSEHPSARPS  138 (162)
T ss_pred             CccccCceeceEEch-HHHHHhccCCccCcccccccc-cCHHHHHHHHHhhCCCCCCc
Confidence            355654433322221 144556678889998889754 46678999999999887654


No 72 
>KOG4173 consensus Alpha-SNAP protein [Intracellular trafficking, secretion, and vesicular transport]
Probab=84.11  E-value=0.37  Score=36.95  Aligned_cols=47  Identities=19%  Similarity=0.350  Sum_probs=24.9

Q ss_pred             ccccCCChHHHHHHHH-Hhc---------CCCcccCCCCCCCccccchhhHHHHHHH
Q 026846            2 KAVAFSLDFNLRSHMK-THS---------QENYHICPYPDCGKRYAHEYKLKNHIAS   48 (232)
Q Consensus         2 C~~~f~~~~~L~~H~~-~H~---------~~~p~~C~~~~C~~~f~~~~~l~~H~~~   48 (232)
                      |.++|.+..-|..|+. .|.         |.-.|.|-+..|+..|.+.-..+.|+..
T Consensus       112 C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~  168 (253)
T KOG4173|consen  112 CKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIR  168 (253)
T ss_pred             HHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHH
Confidence            5555555555555543 231         3344555555566556555555555443


No 73 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=82.64  E-value=1  Score=26.32  Aligned_cols=25  Identities=40%  Similarity=0.856  Sum_probs=19.4

Q ss_pred             ccCCcccccccccCh-----HHHHHHHHhhCC
Q 026846           88 YACPYEGCEKAYIHE-----YKLKLHLKREHP  114 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~-----~~l~~H~~~~h~  114 (232)
                      =.|.+  |++.+...     ++|.+|++..|+
T Consensus        19 a~C~~--C~~~l~~~~~~gTs~L~rHl~~~h~   48 (50)
T smart00614       19 AKCKY--CGKKLSRSSKGGTSNLRRHLRRKHP   48 (50)
T ss_pred             EEecC--CCCEeeeCCCCCcHHHHHHHHhHCc
Confidence            46888  99988765     699999985454


No 74 
>KOG2231 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=82.45  E-value=1.2  Score=40.58  Aligned_cols=103  Identities=16%  Similarity=0.164  Sum_probs=56.4

Q ss_pred             CChHHHHHHHH-HhcCCCcccCC-----CCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccc
Q 026846            7 SLDFNLRSHMK-THSQENYHICP-----YPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYG   80 (232)
Q Consensus         7 ~~~~~L~~H~~-~H~~~~p~~C~-----~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~   80 (232)
                      .....|+.|+. .|..-.-..|.     +..|.|-|. ...|+.|+..--..-......-.|..|...|-....|+.|++
T Consensus       125 ~s~~~Lk~H~~~~H~~~~c~lC~~~~kif~~e~k~Yt-~~el~~h~~~gd~d~~s~rGhp~C~~C~~~fld~~el~rH~~  203 (669)
T KOG2231|consen  125 KSVENLKNHMRDQHKLHLCSLCLQNLKIFINERKLYT-RAELNLHLMFGDPDDESCRGHPLCKFCHERFLDDDELYRHLR  203 (669)
T ss_pred             hHHHHHHHHHHHhhhhhccccccccceeeeeeeeheh-HHHHHHHHhcCCCccccccCCccchhhhhhhccHHHHHHhhc
Confidence            35677888884 56432221221     001334443 455666655421100010111333667777777777888877


Q ss_pred             cCCCCCCccCCc----ccccccccChHHHHHHHHhhCC
Q 026846           81 SASSERPYACPY----EGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        81 ~H~~~k~~~C~~----~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                      .+.    |.|.+    .+++..|.....|..|-+..|-
T Consensus       204 ~~h----~~chfC~~~~~~neyy~~~~dLe~HfR~~Hf  237 (669)
T KOG2231|consen  204 FDH----EFCHFCDYKTGQNEYYNDYDDLEEHFRKGHF  237 (669)
T ss_pred             cce----eheeecCcccccchhcccchHHHHHhhhcCc
Confidence            654    44444    2245668888999999988774


No 75 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=81.59  E-value=1.2  Score=30.91  Aligned_cols=26  Identities=27%  Similarity=0.604  Sum_probs=23.0

Q ss_pred             CccC----CcccccccccChHHHHHHHHhhCC
Q 026846           87 PYAC----PYEGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        87 ~~~C----~~~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                      .|.|    ..  |+..+++...|.+|++.+|+
T Consensus        80 G~~C~~~~~~--C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   80 GYRCQCDPPH--CGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             CeeeecCCCC--CCcEeccHHHHHHHHHHhcC
Confidence            4889    66  99999999999999998874


No 76 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=79.90  E-value=0.86  Score=38.58  Aligned_cols=7  Identities=14%  Similarity=-0.164  Sum_probs=3.1

Q ss_pred             HHHHHHh
Q 026846          105 LKLHLKR  111 (232)
Q Consensus       105 l~~H~~~  111 (232)
                      +..|...
T Consensus       145 ~a~hr~~  151 (514)
T KOG3130|consen  145 KAKHRIA  151 (514)
T ss_pred             HHHHHhh
Confidence            4455433


No 77 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=74.96  E-value=3.9  Score=34.06  Aligned_cols=21  Identities=24%  Similarity=0.358  Sum_probs=18.3

Q ss_pred             CccccCCChHHHHHHHHH--hcC
Q 026846            1 MKAVAFSLDFNLRSHMKT--HSQ   21 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~--H~~   21 (232)
                      ||.|.|..+..|+.||+.  |..
T Consensus       200 yCekifrdkntLkeHMrkK~Hrr  222 (423)
T KOG2482|consen  200 YCEKIFRDKNTLKEHMRKKRHRR  222 (423)
T ss_pred             eeccccCCcHHHHHHHHhccCcc
Confidence            799999999999999984  554


No 78 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=73.96  E-value=1.8  Score=25.83  Aligned_cols=31  Identities=23%  Similarity=0.593  Sum_probs=25.7

Q ss_pred             HhcCCCcccCCCCCCCccccchhhHHHHHHHhc
Q 026846           18 THSQENYHICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        18 ~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      .-.|+-.+.|+  .|++.|..+-...+|+..-+
T Consensus        11 ~RDGE~~lrCP--RC~~~FR~~K~Y~RHVNKaH   41 (65)
T COG4049          11 DRDGEEFLRCP--RCGMVFRRRKDYIRHVNKAH   41 (65)
T ss_pred             ccCCceeeeCC--chhHHHHHhHHHHHHhhHHh
Confidence            34678889995  79999999999999987643


No 79 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=71.41  E-value=2.7  Score=32.96  Aligned_cols=32  Identities=25%  Similarity=0.605  Sum_probs=24.4

Q ss_pred             CCCCccCCcccccccccChHHHHHHHHhhCCCCC
Q 026846           84 SERPYACPYEGCEKAYIHEYKLKLHLKREHPGHM  117 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~  117 (232)
                      .+..|.|..  |+|.|.-..-+++|+...|....
T Consensus        74 ~~~K~~C~l--c~KlFkg~eFV~KHI~nKH~e~v  105 (214)
T PF04959_consen   74 DEDKWRCPL--CGKLFKGPEFVRKHIFNKHPEKV  105 (214)
T ss_dssp             SSEEEEE-S--SS-EESSHHHHHHHHHHH-HHHH
T ss_pred             cCCEECCCC--CCcccCChHHHHHHHhhcCHHHH
Confidence            355699987  99999999999999999887543


No 80 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=69.20  E-value=3.2  Score=29.88  Aligned_cols=27  Identities=30%  Similarity=0.432  Sum_probs=16.3

Q ss_pred             CCCccCCcccccccccChHHHHHHHHhhCCCC
Q 026846           85 ERPYACPYEGCEKAYIHEYKLKLHLKREHPGH  116 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~  116 (232)
                      ..-..|-.  |||.|..   |++|++.||+-.
T Consensus        70 ~d~i~cle--cGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   70 PDYIICLE--CGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             SS-EE-TB--T--EESB---HHHHHHHTT-S-
T ss_pred             cCeeEEcc--CCcccch---HHHHHHHccCCC
Confidence            34467866  9999987   599999987653


No 81 
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=68.34  E-value=3  Score=33.17  Aligned_cols=47  Identities=21%  Similarity=0.552  Sum_probs=33.7

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChH
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEY  103 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~  103 (232)
                      .|.|.+  ||-... +..+.+|+...++                                  .-|.|..  |+++|.+ .
T Consensus         3 ~FtCnv--CgEsvK-Kp~vekH~srCrn----------------------------------~~fSCID--C~k~F~~-~   42 (276)
T KOG2186|consen    3 FFTCNV--CGESVK-KPQVEKHMSRCRN----------------------------------AYFSCID--CGKTFER-V   42 (276)
T ss_pred             EEehhh--hhhhcc-ccchHHHHHhccC----------------------------------CeeEEee--ccccccc-c
Confidence            378864  998766 4557778877642                                  4588876  9999988 5


Q ss_pred             HHHHHHH
Q 026846          104 KLKLHLK  110 (232)
Q Consensus       104 ~l~~H~~  110 (232)
                      ..+.|.+
T Consensus        43 sYknH~k   49 (276)
T KOG2186|consen   43 SYKNHTK   49 (276)
T ss_pred             hhhhhhh
Confidence            6677754


No 82 
>PF03145 Sina:  Seven in absentia protein family;  InterPro: IPR018121 The seven in absentia (sina) gene was first identified in Drosophila. The Drosophila Sina protein is essential for the determination of the R7 pathway in photoreceptor cell development: the loss of functional Sina results in the transformation of the R7 precursor cell to a non-neuronal cell type. The Sina protein contains an N-terminal RING finger domain C3HC4-type. Through this domain, Sina binds E2 ubiquitin-conjugating enzymes (UbcD1) Sina also interacts with Tramtrack (TTK88) via PHYL. Tramtrack is a transcriptional repressor that blocks photoreceptor determination, while PHYL down-regulates the activity of TTK88. In turn, the activity of PHYL requires the activation of the Sevenless receptor tyrosine kinase, a process essential for R7 determination. It is thought that Sina targets TTK88 for degradation, therefore promoting the R7 pathway. Murine and human homologues of Sina have also been identified. The human homologue Siah-1 [] also binds E2 enzymes (UbcH5) and through a series of physical interactions, targets beta-catenin for ubiquitin degradation. Siah-1 expression is enhanced by p53, itself promoted by DNA damage. Thus this pathway links DNA damage to beta-catenin degradation [, ]. Sina proteins, therefore, physically interact with a variety of proteins. The N-terminal RING finger domain that binds ubiquitin conjugating enzymes is a C3HC4-type, and does not form part of the alignment for this family. The remainder C-terminal part is involved in interactions with other proteins, and is included in this alignment. In addition to the Drosophila protein and mammalian homologues, whose similarity was noted previously, this family also includes putative homologues from Caenorhabditis elegans, Arabidopsis thaliana.; GO: 0006511 ubiquitin-dependent protein catabolic process, 0007275 multicellular organismal development, 0005634 nucleus; PDB: 2A25_A 1K2F_B 2AN6_C.
Probab=68.23  E-value=4.2  Score=31.34  Aligned_cols=58  Identities=22%  Similarity=0.456  Sum_probs=32.9

Q ss_pred             cccCCC--CCCCccccchhhHHHHHHHhcCCCCCccCCcCCCCCccccCCCCCcccccccCCCCCCccCCc--ccccccc
Q 026846           24 YHICPY--PDCGKRYAHEYKLKNHIASHHEKNAAVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPY--EGCEKAY   99 (232)
Q Consensus        24 p~~C~~--~~C~~~f~~~~~l~~H~~~h~~~~~~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~--~~C~k~f   99 (232)
                      .|.|++  ..|...|.. .....|.+..                                  .-+||.|+.  .+|++.=
T Consensus        14 ~~pC~~~~~GC~~~~~~-~~~~~HE~~C----------------------------------~~~p~~CP~~~~~C~~~G   58 (198)
T PF03145_consen   14 KFPCKNAKYGCTETFPY-SEKREHEEEC----------------------------------PFRPCSCPFPGSGCDWQG   58 (198)
T ss_dssp             -EE-CCGGGT---EE-G-GGHHHHHHT-----------------------------------TTSEEE-SSSSTT---EE
T ss_pred             eecCCCCCCCCcccccc-cChhhHhccC----------------------------------CCcCCcCCCCCCCccccC
Confidence            477775  358877665 4567777765                                  257899987  6787654


Q ss_pred             cChHHHHHHHHhhCCCCC
Q 026846          100 IHEYKLKLHLKREHPGHM  117 (232)
Q Consensus       100 ~~~~~l~~H~~~~h~~~~  117 (232)
                       ....|..|....|....
T Consensus        59 -~~~~l~~Hl~~~H~~~~   75 (198)
T PF03145_consen   59 -SYKELLDHLRDKHSWNV   75 (198)
T ss_dssp             -ECCCHHHHHHHHTTTSE
T ss_pred             -CHHHHHHHHHHHCCCcc
Confidence             45689999998887643


No 83 
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=67.55  E-value=3.3  Score=29.79  Aligned_cols=24  Identities=42%  Similarity=0.956  Sum_probs=15.6

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhcCCC
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHHEKN   53 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~   53 (232)
                      -.|-  .||+.|..   |++|++.|+|-.
T Consensus        73 i~cl--ecGk~~k~---LkrHL~~~~glt   96 (132)
T PF05443_consen   73 IICL--ECGKKFKT---LKRHLRTHHGLT   96 (132)
T ss_dssp             EE-T--BT--EESB---HHHHHHHTT-S-
T ss_pred             eEEc--cCCcccch---HHHHHHHccCCC
Confidence            5685  59999998   699999997643


No 84 
>KOG2785 consensus C2H2-type Zn-finger protein [General function prediction only]
Probab=67.04  E-value=6.1  Score=33.45  Aligned_cols=46  Identities=13%  Similarity=0.145  Sum_probs=37.3

Q ss_pred             CccccCCChHHHHHHHHHhcCC-----------------------CcccCCCCCCC---ccccchhhHHHHHHH
Q 026846            1 MKAVAFSLDFNLRSHMKTHSQE-----------------------NYHICPYPDCG---KRYAHEYKLKNHIAS   48 (232)
Q Consensus         1 ~C~~~f~~~~~L~~H~~~H~~~-----------------------~p~~C~~~~C~---~~f~~~~~l~~H~~~   48 (232)
                      +|++.|..--.-..||..|+|-                       .-|.|.|  |+   +.|.+....+.||..
T Consensus       171 fC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~--CN~~~~~f~sleavr~HM~~  242 (390)
T KOG2785|consen  171 FCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLF--CNELGRPFSSLEAVRAHMRD  242 (390)
T ss_pred             ecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEE--eccccCcccccHHHHHHHhh
Confidence            6888988888888999887762                       2378876  88   889999999999875


No 85 
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=66.92  E-value=10  Score=21.50  Aligned_cols=22  Identities=27%  Similarity=0.404  Sum_probs=18.7

Q ss_pred             ccCCcccccccccChHHHHHHHHh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |+|-+  |..+..-+++|-.||+.
T Consensus        21 ykcfq--cpftc~~kshl~nhmky   42 (54)
T PF15269_consen   21 YKCFQ--CPFTCNEKSHLFNHMKY   42 (54)
T ss_pred             ceeec--CCcccchHHHHHHHHHH
Confidence            67877  99888899999999875


No 86 
>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]
Probab=66.75  E-value=2.8  Score=33.43  Aligned_cols=17  Identities=6%  Similarity=0.391  Sum_probs=9.6

Q ss_pred             ccccccChHHHHHHHHh
Q 026846           95 CEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        95 C~k~f~~~~~l~~H~~~  111 (232)
                      |...|+.-+++..-++.
T Consensus       108 cKQRltklTQylir~rk  124 (303)
T KOG3064|consen  108 CKQRLTKLTQYLIRMRK  124 (303)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            55567766665554443


No 87 
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=61.95  E-value=4.2  Score=36.11  Aligned_cols=11  Identities=18%  Similarity=0.374  Sum_probs=5.6

Q ss_pred             ccccccChHHH
Q 026846           95 CEKAYIHEYKL  105 (232)
Q Consensus        95 C~k~f~~~~~l  105 (232)
                      ||.+|.+...+
T Consensus       158 cGFaFV~fk~~  168 (678)
T KOG0127|consen  158 CGFAFVQFKEK  168 (678)
T ss_pred             cceEEEEEeeH
Confidence            55555544433


No 88 
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=59.16  E-value=8.1  Score=26.62  Aligned_cols=27  Identities=22%  Similarity=0.455  Sum_probs=22.3

Q ss_pred             ccC--CCCCCCccccchhhHHHHHHHhcC
Q 026846           25 HIC--PYPDCGKRYAHEYKLKNHIASHHE   51 (232)
Q Consensus        25 ~~C--~~~~C~~~f~~~~~l~~H~~~h~~   51 (232)
                      |.|  ..+.|++.+.+...+++|.+.++|
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~Hg  109 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKEHG  109 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHhcC
Confidence            889  234699999999999999998753


No 89 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=55.18  E-value=40  Score=23.50  Aligned_cols=84  Identities=17%  Similarity=0.246  Sum_probs=51.4

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCccC-------CcCCCCCccccCCCCCcccccccCCCCCCccCCccc
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAVEV-------PRYATPPERITKTPKPPAGVYGSASSERPYACPYEG   94 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~c~-------~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~   94 (232)
                      +-|-.|++  |+-.......|.+.--.-..-++|...       ...+-.|.+.|........-  .-.....|.|..  
T Consensus        13 ~LP~~Cpi--CgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~~--~~~~~~~y~C~~--   86 (112)
T TIGR00622        13 ELPVECPI--CGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPFD--ELKDSHRYVCAV--   86 (112)
T ss_pred             CCCCcCCc--CCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCccccccc--ccccccceeCCC--
Confidence            35778875  999999999998753221234445322       12356777777543211100  012234699977  


Q ss_pred             ccccccChHHHHHHHHh
Q 026846           95 CEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        95 C~k~f~~~~~l~~H~~~  111 (232)
                      |...|-..-.+-.|...
T Consensus        87 C~~~FC~dCD~fiHe~L  103 (112)
T TIGR00622        87 CKNVFCVDCDVFVHESL  103 (112)
T ss_pred             CCCccccccchhhhhhc
Confidence            99999888887788655


No 90 
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=54.79  E-value=6.2  Score=28.26  Aligned_cols=25  Identities=32%  Similarity=0.635  Sum_probs=19.6

Q ss_pred             ccCCCCCCCccccchhhHHHHHHHhcCCCC
Q 026846           25 HICPYPDCGKRYAHEYKLKNHIASHHEKNA   54 (232)
Q Consensus        25 ~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~   54 (232)
                      ..|-  +|||.|.+   |++|+.+|.+--|
T Consensus        77 IicL--EDGkkfKS---LKRHL~t~~gmTP  101 (148)
T COG4957          77 IICL--EDGKKFKS---LKRHLTTHYGLTP  101 (148)
T ss_pred             EEEe--ccCcchHH---HHHHHhcccCCCH
Confidence            4674  69999986   9999999976433


No 91 
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=54.75  E-value=11  Score=32.92  Aligned_cols=7  Identities=57%  Similarity=1.274  Sum_probs=3.4

Q ss_pred             CCCccCC
Q 026846           85 ERPYACP   91 (232)
Q Consensus        85 ~k~~~C~   91 (232)
                      .+||.|.
T Consensus       114 Vrp~~Cl  120 (615)
T KOG3540|consen  114 VRPYRCL  120 (615)
T ss_pred             cccceee
Confidence            3455553


No 92 
>KOG4124 consensus Putative transcriptional repressor regulating G2/M transition [Transcription; Cell cycle control, cell division, chromosome partitioning]
Probab=53.85  E-value=11  Score=31.67  Aligned_cols=31  Identities=16%  Similarity=0.090  Sum_probs=23.7

Q ss_pred             CCCCCccCCcccccccccChHHHHHHHHhhCCCC
Q 026846           83 SSERPYACPYEGCEKAYIHEYKLKLHLKREHPGH  116 (232)
Q Consensus        83 ~~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~  116 (232)
                      +..+||+|.   |++++.++..|+-|--..|.+.
T Consensus       209 t~~~p~k~~---~~~~~~T~~~l~~HS~N~~~~~  239 (442)
T KOG4124|consen  209 TTGTPKKMP---ESLVMDTSSPLSDHSMNIDVGE  239 (442)
T ss_pred             cccCCccCc---ccccccccchhhhccccCCCCc
Confidence            346899996   9999999999988855445443


No 93 
>PF12907 zf-met2:  Zinc-binding
Probab=50.87  E-value=5.1  Score=22.31  Aligned_cols=27  Identities=30%  Similarity=0.730  Sum_probs=20.8

Q ss_pred             ccCCccccccccc---ChHHHHHHHHhhCCCC
Q 026846           88 YACPYEGCEKAYI---HEYKLKLHLKREHPGH  116 (232)
Q Consensus        88 ~~C~~~~C~k~f~---~~~~l~~H~~~~h~~~  116 (232)
                      +.|.+  |..+|.   ....|..|....|+..
T Consensus         2 i~C~i--C~qtF~~t~~~~~L~eH~enKHpK~   31 (40)
T PF12907_consen    2 IICKI--CRQTFMQTTNEPQLKEHAENKHPKN   31 (40)
T ss_pred             cCcHH--hhHHHHhcCCHHHHHHHHHccCCCC
Confidence            57888  997775   4567999998878764


No 94 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=50.11  E-value=15  Score=18.20  Aligned_cols=20  Identities=30%  Similarity=0.615  Sum_probs=15.3

Q ss_pred             ccCCcccccccccChHHHHHHHH
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLK  110 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~  110 (232)
                      ..|++  |++.+ ....+..|+.
T Consensus         2 v~CPi--C~~~v-~~~~in~HLD   21 (26)
T smart00734        2 VQCPV--CFREV-PENLINSHLD   21 (26)
T ss_pred             CcCCC--CcCcc-cHHHHHHHHH
Confidence            35877  99988 6677888875


No 95 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=48.42  E-value=7.1  Score=24.87  Aligned_cols=20  Identities=25%  Similarity=0.444  Sum_probs=14.8

Q ss_pred             CCCccCCcccccccccChHH
Q 026846           85 ERPYACPYEGCEKAYIHEYK  104 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~~~  104 (232)
                      ++-+.|....||.+|...-.
T Consensus        25 ~~Y~qC~N~eCg~tF~t~es   44 (72)
T PRK09678         25 ERYHQCQNVNCSATFITYES   44 (72)
T ss_pred             eeeeecCCCCCCCEEEEEEE
Confidence            56688985569999987543


No 96 
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=47.10  E-value=10  Score=22.67  Aligned_cols=26  Identities=19%  Similarity=0.399  Sum_probs=13.3

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHH
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIAS   48 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~   48 (232)
                      ..+-.|++ .|+..-..+..|..|+..
T Consensus         7 ~~~v~C~~-~cc~~~i~r~~l~~H~~~   32 (60)
T PF02176_consen    7 FRPVPCPN-GCCNEMIPRKELDDHLEN   32 (60)
T ss_dssp             TSEEE-TT---S-BEEECCCHHHHHHT
T ss_pred             CCEeeCCC-CCcccceeHHHHHHHHHc
Confidence            34566764 455443445678888773


No 97 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=46.97  E-value=14  Score=29.03  Aligned_cols=28  Identities=32%  Similarity=0.661  Sum_probs=21.5

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHE   51 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~   51 (232)
                      +..|.|.+  |+|.|.-..-+++|+..-|.
T Consensus        75 ~~K~~C~l--c~KlFkg~eFV~KHI~nKH~  102 (214)
T PF04959_consen   75 EDKWRCPL--CGKLFKGPEFVRKHIFNKHP  102 (214)
T ss_dssp             SEEEEE-S--SS-EESSHHHHHHHHHHH-H
T ss_pred             CCEECCCC--CCcccCChHHHHHHHhhcCH
Confidence            44599975  99999999999999998653


No 98 
>COG5137 Histone chaperone involved in gene silencing [Transcription / Chromatin structure and dynamics]
Probab=46.10  E-value=8.8  Score=29.89  Aligned_cols=14  Identities=14%  Similarity=0.484  Sum_probs=7.3

Q ss_pred             ccCCcccccccccChH
Q 026846           88 YACPYEGCEKAYIHEY  103 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~  103 (232)
                      ..|.+  =|+.|.+-+
T Consensus        97 lsc~Y--~g~eFvRvG  110 (279)
T COG5137          97 LSCRY--KGQEFVRVG  110 (279)
T ss_pred             EEEee--cCceeEEEE
Confidence            44655  555565443


No 99 
>KOG2482 consensus Predicted C2H2-type Zn-finger protein [Transcription]
Probab=43.79  E-value=18  Score=30.27  Aligned_cols=29  Identities=31%  Similarity=0.638  Sum_probs=23.7

Q ss_pred             CccCCcccccccccChHHHHHHHHhh-CCCCC
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKRE-HPGHM  117 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~~-h~~~~  117 (232)
                      .+.|-+  |-|.|..+..|+.|||.. |....
T Consensus       195 r~~CLy--CekifrdkntLkeHMrkK~Hrrin  224 (423)
T KOG2482|consen  195 RLRCLY--CEKIFRDKNTLKEHMRKKRHRRIN  224 (423)
T ss_pred             hheeee--eccccCCcHHHHHHHHhccCcccC
Confidence            478988  999999999999999864 44433


No 100
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=43.39  E-value=30  Score=25.71  Aligned_cols=24  Identities=17%  Similarity=0.513  Sum_probs=18.5

Q ss_pred             HhcCCCcccCCCCCCCccccchhhHH
Q 026846           18 THSQENYHICPYPDCGKRYAHEYKLK   43 (232)
Q Consensus        18 ~H~~~~p~~C~~~~C~~~f~~~~~l~   43 (232)
                      ...+..-|.|+  .|+.+|+.-..+.
T Consensus       103 ~e~~~~~Y~Cp--~c~~r~tf~eA~~  126 (158)
T TIGR00373       103 FETNNMFFICP--NMCVRFTFNEAME  126 (158)
T ss_pred             hccCCCeEECC--CCCcEeeHHHHHH
Confidence            34567789994  7999999888774


No 101
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=42.82  E-value=5.7  Score=36.56  Aligned_cols=25  Identities=24%  Similarity=0.494  Sum_probs=22.5

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhc
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHH   50 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~   50 (232)
                      -|.|+.  |+|.|..--++..||++|.
T Consensus       792 iFpCre--C~kvF~KiKSrNAHMK~Hr  816 (907)
T KOG4167|consen  792 IFPCRE--CGKVFFKIKSRNAHMKTHR  816 (907)
T ss_pred             eeehHH--HHHHHHHHhhhhHHHHHHH
Confidence            389985  9999999999999999995


No 102
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=40.79  E-value=16  Score=32.66  Aligned_cols=6  Identities=33%  Similarity=1.165  Sum_probs=3.5

Q ss_pred             CCccCC
Q 026846           86 RPYACP   91 (232)
Q Consensus        86 k~~~C~   91 (232)
                      -||+|.
T Consensus       125 LPf~~k  130 (678)
T KOG0127|consen  125 LPFKCK  130 (678)
T ss_pred             CCcccC
Confidence            366664


No 103
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=40.36  E-value=19  Score=31.71  Aligned_cols=32  Identities=28%  Similarity=0.603  Sum_probs=27.8

Q ss_pred             CCCccCCcccccccccChHHHHHHHHhhCCCCCC
Q 026846           85 ERPYACPYEGCEKAYIHEYKLKLHLKREHPGHMS  118 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~~~  118 (232)
                      -+-+.|++  |.+.|.....+..|+...|.+...
T Consensus        55 WrFWiCp~--CskkF~d~~~~~~H~~~eH~~~l~   86 (466)
T PF04780_consen   55 WRFWICPR--CSKKFSDAESCLSHMEQEHPAGLK   86 (466)
T ss_pred             eeEeeCCc--ccceeCCHHHHHHHHHHhhhhhcC
Confidence            45789988  999999999999999988887654


No 104
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=39.72  E-value=19  Score=27.05  Aligned_cols=13  Identities=38%  Similarity=0.956  Sum_probs=10.6

Q ss_pred             CCCCCccCCcccccc
Q 026846           83 SSERPYACPYEGCEK   97 (232)
Q Consensus        83 ~~~k~~~C~~~~C~k   97 (232)
                      .|+.|.+|++  ||.
T Consensus       145 ~ge~P~~CPi--Cga  157 (166)
T COG1592         145 EGEAPEVCPI--CGA  157 (166)
T ss_pred             cCCCCCcCCC--CCC
Confidence            5788999988  983


No 105
>PF03286 Pox_Ag35:  Pox virus Ag35 surface protein;  InterPro: IPR004966 The Pox virus Ag35 surface protein is an evelope protein known as protein H5.; GO: 0019031 viral envelope
Probab=39.42  E-value=1.8e+02  Score=22.59  Aligned_cols=17  Identities=12%  Similarity=0.241  Sum_probs=16.0

Q ss_pred             ccccccChHHHHHHHHh
Q 026846           95 CEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        95 C~k~f~~~~~l~~H~~~  111 (232)
                      ||-.|.+...|+.|+|.
T Consensus        10 ~~~~f~tl~eiR~hlrs   26 (200)
T PF03286_consen   10 GGSNFKTLEEIRAHLRS   26 (200)
T ss_pred             CCccceeHHHHHHHHhh
Confidence            88999999999999987


No 106
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=38.65  E-value=22  Score=18.59  Aligned_cols=11  Identities=45%  Similarity=1.304  Sum_probs=8.5

Q ss_pred             CCCccCCcccccc
Q 026846           85 ERPYACPYEGCEK   97 (232)
Q Consensus        85 ~k~~~C~~~~C~k   97 (232)
                      ..++.|+.  ||.
T Consensus        15 ~~~~~CP~--Cg~   25 (33)
T cd00350          15 EAPWVCPV--CGA   25 (33)
T ss_pred             cCCCcCcC--CCC
Confidence            37899977  975


No 107
>KOG3408 consensus U1-like Zn-finger-containing protein, probabl erole in RNA processing/splicing [RNA processing and modification]
Probab=38.51  E-value=19  Score=25.38  Aligned_cols=26  Identities=27%  Similarity=0.557  Sum_probs=22.2

Q ss_pred             CCCCccCCcccccccccChHHHHHHHHh
Q 026846           84 SERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |...|-|-.  |.+-|.....|..|.++
T Consensus        54 G~GqfyCi~--CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   54 GGGQFYCIE--CARYFIDAKALKTHFKT   79 (129)
T ss_pred             CCceeehhh--hhhhhcchHHHHHHHhc
Confidence            445688966  99999999999999875


No 108
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=38.48  E-value=23  Score=25.94  Aligned_cols=20  Identities=25%  Similarity=0.722  Sum_probs=14.6

Q ss_pred             cCCCcccCCCCCCCccccchhh
Q 026846           20 SQENYHICPYPDCGKRYAHEYK   41 (232)
Q Consensus        20 ~~~~p~~C~~~~C~~~f~~~~~   41 (232)
                      .+..-|.|+  .|+..|.....
T Consensus        95 ~~~~~Y~Cp--~C~~~y~~~ea  114 (147)
T smart00531       95 TNNAYYKCP--NCQSKYTFLEA  114 (147)
T ss_pred             cCCcEEECc--CCCCEeeHHHH
Confidence            355679995  69999986543


No 109
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=37.33  E-value=21  Score=19.25  Aligned_cols=14  Identities=21%  Similarity=0.688  Sum_probs=9.8

Q ss_pred             CCCccCCccccccccc
Q 026846           85 ERPYACPYEGCEKAYI  100 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~  100 (232)
                      .+..+|+.  |+..|.
T Consensus        23 g~~v~C~~--C~~~f~   36 (36)
T PF13717_consen   23 GRKVRCSK--CGHVFF   36 (36)
T ss_pred             CcEEECCC--CCCEeC
Confidence            34578877  988773


No 110
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription]
Probab=36.90  E-value=9.5  Score=35.20  Aligned_cols=27  Identities=19%  Similarity=0.442  Sum_probs=22.3

Q ss_pred             CCccCCcccccccccChHHHHHHHHhhCC
Q 026846           86 RPYACPYEGCEKAYIHEYKLKLHLKREHP  114 (232)
Q Consensus        86 k~~~C~~~~C~k~f~~~~~l~~H~~~~h~  114 (232)
                      .-|.|..  |+|.|-.-..+..||++|..
T Consensus       791 giFpCre--C~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  791 GIFPCRE--CGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             ceeehHH--HHHHHHHHhhhhHHHHHHHH
Confidence            3599977  99999988888899988543


No 111
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=36.63  E-value=24  Score=19.08  Aligned_cols=14  Identities=29%  Similarity=0.778  Sum_probs=10.2

Q ss_pred             CCCccCCccccccccc
Q 026846           85 ERPYACPYEGCEKAYI  100 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~  100 (232)
                      .+..+|..  |+..|.
T Consensus        23 ~~~vrC~~--C~~~f~   36 (37)
T PF13719_consen   23 GRKVRCPK--CGHVFR   36 (37)
T ss_pred             CcEEECCC--CCcEee
Confidence            45678877  988774


No 112
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=35.77  E-value=47  Score=27.97  Aligned_cols=33  Identities=27%  Similarity=0.559  Sum_probs=24.9

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcCCCCCc
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAAV   56 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~~   56 (232)
                      ...|.|+|  |++.-.+...|..|+..-+..-++.
T Consensus        77 ~qSftCPy--C~~~Gfte~~f~~Hv~s~Hpda~~~  109 (381)
T KOG1280|consen   77 PQSFTCPY--CGIMGFTERQFGTHVLSQHPEASTS  109 (381)
T ss_pred             cccccCCc--ccccccchhHHHHHhhhcCcccCcc
Confidence            44699988  9988888888999988766554443


No 113
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=35.40  E-value=23  Score=19.01  Aligned_cols=12  Identities=17%  Similarity=0.564  Sum_probs=8.8

Q ss_pred             CccCCccccccccc
Q 026846           87 PYACPYEGCEKAYI  100 (232)
Q Consensus        87 ~~~C~~~~C~k~f~  100 (232)
                      ...|+.  |+..|.
T Consensus        25 ~v~C~~--C~~~~~   36 (38)
T TIGR02098        25 KVRCGK--CGHVWY   36 (38)
T ss_pred             EEECCC--CCCEEE
Confidence            477877  988774


No 114
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=35.39  E-value=7.7  Score=19.74  Aligned_cols=19  Identities=26%  Similarity=0.536  Sum_probs=11.4

Q ss_pred             ccCCcccccccccChHHHHHHH
Q 026846           88 YACPYEGCEKAYIHEYKLKLHL  109 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~  109 (232)
                      |.|..  |++.|. ....+.|.
T Consensus         1 ~sCiD--C~~~F~-~~~y~~Ht   19 (28)
T PF08790_consen    1 FSCID--CSKDFD-GDSYKSHT   19 (28)
T ss_dssp             EEETT--TTEEEE-GGGTTT--
T ss_pred             Ceeec--CCCCcC-cCCcCCCC
Confidence            46766  999994 44455553


No 115
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=35.25  E-value=1e+02  Score=21.27  Aligned_cols=12  Identities=25%  Similarity=0.852  Sum_probs=8.3

Q ss_pred             ccCCcccccccccC
Q 026846           88 YACPYEGCEKAYIH  101 (232)
Q Consensus        88 ~~C~~~~C~k~f~~  101 (232)
                      ..|..  ||+.|.-
T Consensus        10 R~Cp~--CG~kFYD   21 (108)
T PF09538_consen   10 RTCPS--CGAKFYD   21 (108)
T ss_pred             ccCCC--Ccchhcc
Confidence            56755  8887763


No 116
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=34.35  E-value=22  Score=26.39  Aligned_cols=16  Identities=19%  Similarity=0.374  Sum_probs=11.6

Q ss_pred             CccCCcccccccccChHH
Q 026846           87 PYACPYEGCEKAYIHEYK  104 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~  104 (232)
                      .+.|+.  ||++|...-.
T Consensus        28 ~~~c~~--c~~~f~~~e~   43 (154)
T PRK00464         28 RRECLA--CGKRFTTFER   43 (154)
T ss_pred             eeeccc--cCCcceEeEe
Confidence            388876  9999876543


No 117
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=33.73  E-value=40  Score=23.28  Aligned_cols=20  Identities=25%  Similarity=0.547  Sum_probs=14.9

Q ss_pred             CCCCccCCcccccccccChHHHH
Q 026846           84 SERPYACPYEGCEKAYIHEYKLK  106 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~  106 (232)
                      ...|..|++  ||++| ..+.|.
T Consensus        23 NrdPiVsPy--tG~s~-P~s~fe   42 (129)
T COG4530          23 NRDPIVSPY--TGKSY-PRSYFE   42 (129)
T ss_pred             CCCccccCc--ccccc-hHHHHH
Confidence            367899999  99999 444454


No 118
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=33.56  E-value=27  Score=18.50  Aligned_cols=10  Identities=40%  Similarity=1.085  Sum_probs=7.7

Q ss_pred             CCccCCcccccc
Q 026846           86 RPYACPYEGCEK   97 (232)
Q Consensus        86 k~~~C~~~~C~k   97 (232)
                      .|..|++  ||.
T Consensus        17 ~p~~CP~--Cg~   26 (34)
T cd00729          17 APEKCPI--CGA   26 (34)
T ss_pred             CCCcCcC--CCC
Confidence            5778977  875


No 119
>KOG2295 consensus C2H2 Zn-finger protein [General function prediction only]
Probab=33.50  E-value=27  Score=31.26  Aligned_cols=33  Identities=24%  Similarity=0.646  Sum_probs=28.0

Q ss_pred             CCCCccCCcccccccccChHHHHHHHHhhCCCC
Q 026846           84 SERPYACPYEGCEKAYIHEYKLKLHLKREHPGH  116 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~~H~~~~h~~~  116 (232)
                      +...|-|...+|.|.|.-.--.++|++..|...
T Consensus       506 ~kdKy~C~lsgc~KlF~gpEFvrKHi~~KH~d~  538 (648)
T KOG2295|consen  506 DKDKYLCPLSGCAKLFKGPEFVRKHINKKHKDK  538 (648)
T ss_pred             hcccccCCCcchHhhccCHHHHHHHHHHHHHHH
Confidence            445799999999999999999999999888653


No 120
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=32.85  E-value=24  Score=21.80  Aligned_cols=14  Identities=21%  Similarity=0.517  Sum_probs=5.6

Q ss_pred             CCCccCCccccccccc
Q 026846           85 ERPYACPYEGCEKAYI  100 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~  100 (232)
                      .+.+.|..  ||..|-
T Consensus        23 ~rrhhCr~--CG~~vC   36 (69)
T PF01363_consen   23 RRRHHCRN--CGRVVC   36 (69)
T ss_dssp             S-EEE-TT--T--EEE
T ss_pred             eeeEccCC--CCCEEC
Confidence            34456655  666654


No 121
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=31.82  E-value=22  Score=19.58  Aligned_cols=14  Identities=21%  Similarity=0.667  Sum_probs=11.8

Q ss_pred             CccCCcccccccccCh
Q 026846           87 PYACPYEGCEKAYIHE  102 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~  102 (232)
                      ||.|..  |++.|-..
T Consensus        12 ~f~C~~--C~~~FC~~   25 (39)
T smart00154       12 GFKCRH--CGNLFCGE   25 (39)
T ss_pred             CeECCc--cCCccccc
Confidence            899988  99999754


No 122
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=30.53  E-value=16  Score=28.04  Aligned_cols=15  Identities=27%  Similarity=0.587  Sum_probs=10.6

Q ss_pred             CcccCCCCCCCccccch
Q 026846           23 NYHICPYPDCGKRYAHE   39 (232)
Q Consensus        23 ~p~~C~~~~C~~~f~~~   39 (232)
                      -||.|.+  |.+.|.+.
T Consensus       195 IPF~C~i--CKkdy~sp  209 (259)
T COG5152         195 IPFLCGI--CKKDYESP  209 (259)
T ss_pred             Cceeehh--chhhccch
Confidence            4788876  87777653


No 123
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=30.17  E-value=41  Score=19.74  Aligned_cols=15  Identities=20%  Similarity=0.596  Sum_probs=9.2

Q ss_pred             CCCccCCcccccccccC
Q 026846           85 ERPYACPYEGCEKAYIH  101 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~  101 (232)
                      .+.+.|..  ||+.|-.
T Consensus        16 ~rk~~Cr~--Cg~~~C~   30 (57)
T cd00065          16 RRRHHCRN--CGRIFCS   30 (57)
T ss_pred             ccccccCc--CcCCcCh
Confidence            34566766  7777654


No 124
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=30.09  E-value=21  Score=28.01  Aligned_cols=23  Identities=26%  Similarity=0.576  Sum_probs=15.2

Q ss_pred             CcccCCCCCCCccccchhhHHHHHH
Q 026846           23 NYHICPYPDCGKRYAHEYKLKNHIA   47 (232)
Q Consensus        23 ~p~~C~~~~C~~~f~~~~~l~~H~~   47 (232)
                      +.+.|++  |++.|..+.-+....+
T Consensus         4 k~~~CPv--C~~~F~~~~vrs~~~r   26 (214)
T PF09986_consen    4 KKITCPV--CGKEFKTKKVRSGKIR   26 (214)
T ss_pred             CceECCC--CCCeeeeeEEEcCCce
Confidence            5578865  8888887755444433


No 125
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=29.75  E-value=11  Score=21.68  Aligned_cols=18  Identities=17%  Similarity=0.495  Sum_probs=12.7

Q ss_pred             CCCccCCcccccccccCh
Q 026846           85 ERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~  102 (232)
                      +.-|.|....||.+|...
T Consensus        23 ~~Y~qC~N~~Cg~tfv~~   40 (47)
T PF04606_consen   23 ELYCQCTNPECGHTFVAN   40 (47)
T ss_pred             EEEEEECCCcCCCEEEEE
Confidence            345778777799988753


No 126
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=29.73  E-value=47  Score=25.22  Aligned_cols=21  Identities=19%  Similarity=0.755  Sum_probs=16.0

Q ss_pred             cCCCcccCCCCCCCccccchhhH
Q 026846           20 SQENYHICPYPDCGKRYAHEYKL   42 (232)
Q Consensus        20 ~~~~p~~C~~~~C~~~f~~~~~l   42 (232)
                      ....-|.|+  .|+.+|+.-..+
T Consensus       113 ~~~~~Y~Cp--~C~~rytf~eA~  133 (178)
T PRK06266        113 ENNMFFFCP--NCHIRFTFDEAM  133 (178)
T ss_pred             cCCCEEECC--CCCcEEeHHHHh
Confidence            345679995  699999887765


No 127
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=29.48  E-value=24  Score=23.54  Aligned_cols=16  Identities=19%  Similarity=0.362  Sum_probs=12.0

Q ss_pred             CCCccCCcccccccccCh
Q 026846           85 ERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~  102 (232)
                      ...|.|..  |+++|+-.
T Consensus        52 ~GIW~C~~--C~~~~AGG   67 (90)
T PTZ00255         52 VGIWRCKG--CKKTVAGG   67 (90)
T ss_pred             eEEEEcCC--CCCEEeCC
Confidence            45689976  99998643


No 128
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=29.42  E-value=51  Score=20.07  Aligned_cols=11  Identities=45%  Similarity=1.171  Sum_probs=8.2

Q ss_pred             CCCccCCcccccc
Q 026846           85 ERPYACPYEGCEK   97 (232)
Q Consensus        85 ~k~~~C~~~~C~k   97 (232)
                      ..+|.|+.  ||.
T Consensus        48 g~~Y~Cp~--CGF   58 (61)
T COG2888          48 GNPYRCPK--CGF   58 (61)
T ss_pred             CCceECCC--cCc
Confidence            46899965  984


No 129
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=28.84  E-value=26  Score=23.77  Aligned_cols=20  Identities=20%  Similarity=0.512  Sum_probs=15.7

Q ss_pred             cccCCCCCCccCCcccccccccC
Q 026846           79 YGSASSERPYACPYEGCEKAYIH  101 (232)
Q Consensus        79 ~~~H~~~k~~~C~~~~C~k~f~~  101 (232)
                      ++++.| +|+.|..  ||..|.-
T Consensus        72 ~~l~~g-~~~rC~e--CG~~fkL   91 (97)
T cd00924          72 MWLEKG-KPKRCPE--CGHVFKL   91 (97)
T ss_pred             EEEeCC-CceeCCC--CCcEEEE
Confidence            556777 7999976  9998863


No 130
>KOG0717 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=28.59  E-value=30  Score=30.32  Aligned_cols=23  Identities=30%  Similarity=0.553  Sum_probs=20.3

Q ss_pred             ccCCcccccccccChHHHHHHHHhh
Q 026846           88 YACPYEGCEKAYIHEYKLKLHLKRE  112 (232)
Q Consensus        88 ~~C~~~~C~k~f~~~~~l~~H~~~~  112 (232)
                      +-|.+  |+|+|.+..+|..|.++.
T Consensus       293 lyC~v--CnKsFKseKq~kNHEnSK  315 (508)
T KOG0717|consen  293 LYCVV--CNKSFKSEKQLKNHENSK  315 (508)
T ss_pred             eEEee--ccccccchHHHHhhHHHH
Confidence            77988  999999999999998753


No 131
>KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown]
Probab=27.85  E-value=25  Score=23.79  Aligned_cols=13  Identities=23%  Similarity=0.731  Sum_probs=7.9

Q ss_pred             CccCCcccccccccC
Q 026846           87 PYACPYEGCEKAYIH  101 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~  101 (232)
                      ...|.+  |+.+|..
T Consensus        47 ~~sC~i--C~esFqt   59 (109)
T KOG3214|consen   47 KASCRI--CEESFQT   59 (109)
T ss_pred             eeeeee--hhhhhcc
Confidence            345666  7766654


No 132
>KOG4434 consensus Molecular chaperone SEC63, endoplasmic reticulum translocon component [Intracellular trafficking, secretion, and vesicular transport; Posttranslational modification, protein turnover, chaperones]
Probab=27.80  E-value=22  Score=30.23  Aligned_cols=11  Identities=18%  Similarity=0.187  Sum_probs=4.7

Q ss_pred             cccchhhHHHH
Q 026846           35 RYAHEYKLKNH   45 (232)
Q Consensus        35 ~f~~~~~l~~H   45 (232)
                      +...+.-|..|
T Consensus        68 slKaRvlLhah   78 (520)
T KOG4434|consen   68 SLKARVLLHAH   78 (520)
T ss_pred             hHHHHHHHHHH
Confidence            44444444444


No 133
>KOG2071 consensus mRNA cleavage and polyadenylation factor I/II complex, subunit Pcf11 [RNA processing and modification]
Probab=27.18  E-value=40  Score=30.46  Aligned_cols=28  Identities=21%  Similarity=0.567  Sum_probs=24.0

Q ss_pred             CCcccCCCCCCCccccchhhHHHHHHHhcC
Q 026846           22 ENYHICPYPDCGKRYAHEYKLKNHIASHHE   51 (232)
Q Consensus        22 ~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~   51 (232)
                      .+|..|..  ||.+|........||-.|..
T Consensus       416 ~~pnqC~~--CG~R~~~~ee~sk~md~H~d  443 (579)
T KOG2071|consen  416 DSPNQCKS--CGLRFDDSEERSKHMDIHDD  443 (579)
T ss_pred             CCcchhcc--cccccccchhhhhHhhhhhh
Confidence            56789975  99999999999999988853


No 134
>KOG2051 consensus Nonsense-mediated mRNA decay 2 protein [RNA processing and modification]
Probab=27.06  E-value=68  Score=31.28  Aligned_cols=8  Identities=13%  Similarity=0.509  Sum_probs=4.1

Q ss_pred             ccccccCh
Q 026846           95 CEKAYIHE  102 (232)
Q Consensus        95 C~k~f~~~  102 (232)
                      ||..|.+.
T Consensus       788 c~~yf~rg  795 (1128)
T KOG2051|consen  788 CGPYFTRG  795 (1128)
T ss_pred             cccccccc
Confidence            55555443


No 135
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]
Probab=26.50  E-value=10  Score=34.06  Aligned_cols=30  Identities=20%  Similarity=0.454  Sum_probs=17.8

Q ss_pred             HHHHHHHHHhcCCCcccCCCCCCCccccchhh
Q 026846           10 FNLRSHMKTHSQENYHICPYPDCGKRYAHEYK   41 (232)
Q Consensus        10 ~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~   41 (232)
                      +.|.+|..+|....--+|.  .|+|.|.++-.
T Consensus       239 ~~fvrHHWVHrrRqeGkC~--~CgKgFQQKf~  268 (1004)
T KOG0782|consen  239 SGFVRHHWVHRRRQEGKCN--TCGKGFQQKFF  268 (1004)
T ss_pred             ccchHHhHhhHhhhccccc--hhhhhhhhhee
Confidence            3556666666555555675  47777766543


No 136
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=26.15  E-value=36  Score=18.92  Aligned_cols=13  Identities=46%  Similarity=1.372  Sum_probs=10.8

Q ss_pred             CCccCCccccccccc
Q 026846           86 RPYACPYEGCEKAYI  100 (232)
Q Consensus        86 k~~~C~~~~C~k~f~  100 (232)
                      ++-.|++  ||..|.
T Consensus        28 ~~~~CpY--Cg~~yv   40 (40)
T PF10276_consen   28 GPVVCPY--CGTRYV   40 (40)
T ss_dssp             CEEEETT--TTEEEE
T ss_pred             CeEECCC--CCCEEC
Confidence            5789999  999884


No 137
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=25.92  E-value=24  Score=23.59  Aligned_cols=15  Identities=13%  Similarity=0.496  Sum_probs=11.5

Q ss_pred             CCCccCCcccccccccC
Q 026846           85 ERPYACPYEGCEKAYIH  101 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~  101 (232)
                      ...|.|..  |+++|+-
T Consensus        51 ~GIW~C~~--C~~~~AG   65 (91)
T TIGR00280        51 TGIWTCRK--CGAKFAG   65 (91)
T ss_pred             eEEEEcCC--CCCEEeC
Confidence            45689977  9998864


No 138
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=25.83  E-value=47  Score=21.98  Aligned_cols=15  Identities=13%  Similarity=0.474  Sum_probs=11.5

Q ss_pred             CCCccCCcccccccccC
Q 026846           85 ERPYACPYEGCEKAYIH  101 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~  101 (232)
                      ..-|.|.-  ||+.|+-
T Consensus        51 ~GIW~C~k--Cg~~fAG   65 (89)
T COG1997          51 TGIWKCRK--CGAKFAG   65 (89)
T ss_pred             cCeEEcCC--CCCeecc
Confidence            45689977  9999864


No 140
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=25.12  E-value=35  Score=16.94  Aligned_cols=11  Identities=27%  Similarity=0.703  Sum_probs=7.9

Q ss_pred             ccCCccccccccc
Q 026846           88 YACPYEGCEKAYI  100 (232)
Q Consensus        88 ~~C~~~~C~k~f~  100 (232)
                      -.|+.  ||..|.
T Consensus        15 ~~Cp~--CG~~F~   25 (26)
T PF10571_consen   15 KFCPH--CGYDFE   25 (26)
T ss_pred             CcCCC--CCCCCc
Confidence            45766  888875


No 141
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=24.86  E-value=35  Score=24.82  Aligned_cols=38  Identities=18%  Similarity=0.328  Sum_probs=27.4

Q ss_pred             CccCCcCCCCCccccCCCCCcccccccCCCCCCccCCcccccccccChHHHHHHHHh
Q 026846           55 AVEVPRYATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        55 ~~c~~~~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      |+-...||.+||.                 .-+|.|..  ||-.+-...=|..|..+
T Consensus       114 ~KP~r~fCaVCG~-----------------~S~ysC~~--CG~kyCsv~C~~~HneT  151 (156)
T KOG3362|consen  114 FKPLRKFCAVCGY-----------------DSKYSCVN--CGTKYCSVRCLKTHNET  151 (156)
T ss_pred             CCCcchhhhhcCC-----------------CchhHHHh--cCCceeechhhhhcccc
Confidence            3344567788883                 35699977  99999888888777543


No 142
>KOG2593 consensus Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=24.56  E-value=42  Score=29.12  Aligned_cols=22  Identities=27%  Similarity=0.643  Sum_probs=17.0

Q ss_pred             cCCCcccCCCCCCCccccchhhHH
Q 026846           20 SQENYHICPYPDCGKRYAHEYKLK   43 (232)
Q Consensus        20 ~~~~p~~C~~~~C~~~f~~~~~l~   43 (232)
                      +...-|.|+  .|.+.|+....++
T Consensus       124 t~~~~Y~Cp--~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  124 TNVAGYVCP--NCQKKYTSLEALQ  145 (436)
T ss_pred             cccccccCC--ccccchhhhHHHH
Confidence            456679996  5999999876654


No 143
>KOG4377 consensus Zn-finger protein [General function prediction only]
Probab=24.20  E-value=58  Score=28.13  Aligned_cols=74  Identities=12%  Similarity=0.168  Sum_probs=44.0

Q ss_pred             cccCCCCCCCccccchhhHHHHHHHhcCCCC--------Cc-cCCcCCCCCccccCCCCCcccccccCC-----CCC--C
Q 026846           24 YHICPYPDCGKRYAHEYKLKNHIASHHEKNA--------AV-EVPRYATPPERITKTPKPPAGVYGSAS-----SER--P   87 (232)
Q Consensus        24 p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~--------~~-c~~~~~~~c~~~~~~~~~l~~H~~~H~-----~~k--~   87 (232)
                      -|.|.-+.|++.+.++..+.+|...|-.+.-        |+ |.-+.-..|.|   +-+....|-.-|+     |-+  -
T Consensus       271 hyhcl~e~C~ykr~~k~DvirH~~~hkkrdnsL~dgf~rfs~syhC~~~~C~k---sTsdV~~h~nFht~~~n~Gfrrth  347 (480)
T KOG4377|consen  271 HYHCLNEYCFYKRGQKNDVIRHVEIHKKRDNSLIDGFHRFSNSYHCTGQICEK---STSDVLLHDNFHTDKRNNGFRRTH  347 (480)
T ss_pred             hhcccCccccccccchhhhHHHHHHHhhcccccccchhhcCccchhhhcccCc---ccccccccCccccccccCceecce
Confidence            3667656799888889999999999865332        11 10111155665   3344444544443     222  3


Q ss_pred             ccCCccccccccc
Q 026846           88 YACPYEGCEKAYI  100 (232)
Q Consensus        88 ~~C~~~~C~k~f~  100 (232)
                      |.|...+|..+|.
T Consensus       348 fhC~r~gCTdtfK  360 (480)
T KOG4377|consen  348 FHCQRIGCTDTFK  360 (480)
T ss_pred             eEEeccCCccccc
Confidence            7788856666766


No 144
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=23.54  E-value=55  Score=28.49  Aligned_cols=29  Identities=10%  Similarity=0.167  Sum_probs=21.9

Q ss_pred             CCCCCccccCCCCCcccccccCCCCCCccCCcccccccccCh
Q 026846           61 YATPPERITKTPKPPAGVYGSASSERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        61 ~~~~c~~~~~~~~~l~~H~~~H~~~k~~~C~~~~C~k~f~~~  102 (232)
                      .|+.||...++.           |.+-|+|+.  ||+.+...
T Consensus       352 ~Cp~Cg~~m~S~-----------G~~g~rC~k--Cg~~~~~~  380 (421)
T COG1571         352 VCPRCGGRMKSA-----------GRNGFRCKK--CGTRARET  380 (421)
T ss_pred             CCCccCCchhhc-----------CCCCccccc--ccccCCcc
Confidence            457788877763           556899987  99888765


No 145
>PHA00626 hypothetical protein
Probab=23.12  E-value=38  Score=20.35  Aligned_cols=16  Identities=19%  Similarity=0.412  Sum_probs=12.6

Q ss_pred             CCCccCCcccccccccCh
Q 026846           85 ERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~~  102 (232)
                      ...|+|..  ||..|+..
T Consensus        21 snrYkCkd--CGY~ft~~   36 (59)
T PHA00626         21 SDDYVCCD--CGYNDSKD   36 (59)
T ss_pred             CcceEcCC--CCCeechh
Confidence            35799987  99998754


No 146
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=23.03  E-value=28  Score=23.24  Aligned_cols=15  Identities=13%  Similarity=0.483  Sum_probs=11.5

Q ss_pred             CCCccCCcccccccccC
Q 026846           85 ERPYACPYEGCEKAYIH  101 (232)
Q Consensus        85 ~k~~~C~~~~C~k~f~~  101 (232)
                      ...|.|..  |+++|+-
T Consensus        52 ~GIW~C~~--C~~~~AG   66 (90)
T PRK03976         52 TGIWECRK--CGAKFAG   66 (90)
T ss_pred             EEEEEcCC--CCCEEeC
Confidence            45689977  9998864


No 147
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=22.78  E-value=37  Score=24.33  Aligned_cols=15  Identities=20%  Similarity=0.629  Sum_probs=12.4

Q ss_pred             CccCCcccccccccChH
Q 026846           87 PYACPYEGCEKAYIHEY  103 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~  103 (232)
                      |++|..  ||+.|...+
T Consensus         1 PH~Ct~--Cg~~f~dgs   15 (131)
T PF09845_consen    1 PHQCTK--CGRVFEDGS   15 (131)
T ss_pred             CcccCc--CCCCcCCCc
Confidence            678987  999998764


No 148
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=22.56  E-value=27  Score=19.51  Aligned_cols=15  Identities=27%  Similarity=0.824  Sum_probs=9.6

Q ss_pred             CCccCCcccccccccCh
Q 026846           86 RPYACPYEGCEKAYIHE  102 (232)
Q Consensus        86 k~~~C~~~~C~k~f~~~  102 (232)
                      -||.|..  |++.|-..
T Consensus        12 ~~~~C~~--C~~~FC~~   26 (43)
T PF01428_consen   12 LPFKCKH--CGKSFCLK   26 (43)
T ss_dssp             SHEE-TT--TS-EE-TT
T ss_pred             CCeECCC--CCcccCcc
Confidence            5899988  99999753


No 149
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=22.33  E-value=55  Score=27.65  Aligned_cols=16  Identities=25%  Similarity=0.407  Sum_probs=7.6

Q ss_pred             ccccchhhHHHHHHHh
Q 026846           34 KRYAHEYKLKNHIASH   49 (232)
Q Consensus        34 ~~f~~~~~l~~H~~~h   49 (232)
                      .+|++.-.|..|--.+
T Consensus       156 htYss~ckLe~~aC~~  171 (434)
T KOG3555|consen  156 HTYSSRCKLEYHACHV  171 (434)
T ss_pred             CeehhhhhHHHHhhhh
Confidence            4455555555554333


No 150
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=22.24  E-value=93  Score=25.68  Aligned_cols=14  Identities=21%  Similarity=0.337  Sum_probs=10.3

Q ss_pred             CcccCCCCCCCccccc
Q 026846           23 NYHICPYPDCGKRYAH   38 (232)
Q Consensus        23 ~p~~C~~~~C~~~f~~   38 (232)
                      -||.|.+  |.+.|..
T Consensus       240 ~Pf~c~i--cr~~f~~  253 (313)
T KOG1813|consen  240 LPFKCFI--CRKYFYR  253 (313)
T ss_pred             CCccccc--ccccccc
Confidence            4788875  8877765


No 151
>KOG2186 consensus Cell growth-regulating nucleolar protein [Cell cycle control, cell division, chromosome partitioning]
Probab=21.60  E-value=48  Score=26.65  Aligned_cols=49  Identities=24%  Similarity=0.424  Sum_probs=34.3

Q ss_pred             ccccCCChHHHHHHHHHhcCCCcccCCCCCCCccccchhhHHHHHHHhcCCCCC
Q 026846            2 KAVAFSLDFNLRSHMKTHSQENYHICPYPDCGKRYAHEYKLKNHIASHHEKNAA   55 (232)
Q Consensus         2 C~~~f~~~~~L~~H~~~H~~~~p~~C~~~~C~~~f~~~~~l~~H~~~h~~~~~~   55 (232)
                      ||-... +..|.+|+-+-++ ..|.|  ..|++.|.. .....|...-+...-|
T Consensus         9 CgEsvK-Kp~vekH~srCrn-~~fSC--IDC~k~F~~-~sYknH~kCITEaQKY   57 (276)
T KOG2186|consen    9 CGESVK-KPQVEKHMSRCRN-AYFSC--IDCGKTFER-VSYKNHTKCITEAQKY   57 (276)
T ss_pred             hhhhcc-ccchHHHHHhccC-CeeEE--eeccccccc-chhhhhhhhcchHHHh
Confidence            444433 3456779877666 67999  489999998 7788888776644333


No 152
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms]
Probab=21.55  E-value=33  Score=31.01  Aligned_cols=27  Identities=11%  Similarity=0.113  Sum_probs=16.7

Q ss_pred             CcccccccCCCCCCccCCcccccccccCh
Q 026846           74 PPAGVYGSASSERPYACPYEGCEKAYIHE  102 (232)
Q Consensus        74 ~l~~H~~~H~~~k~~~C~~~~C~k~f~~~  102 (232)
                      .|.+|-++|....--+|..  |||.|.++
T Consensus       240 ~fvrHHWVHrrRqeGkC~~--CgKgFQQK  266 (1004)
T KOG0782|consen  240 GFVRHHWVHRRRQEGKCNT--CGKGFQQK  266 (1004)
T ss_pred             cchHHhHhhHhhhccccch--hhhhhhhh
Confidence            5666666665555556765  77776554


No 153
>KOG3555 consensus Ca2+-binding proteoglycan Testican [General function prediction only]
Probab=21.27  E-value=60  Score=27.45  Aligned_cols=15  Identities=27%  Similarity=0.219  Sum_probs=6.2

Q ss_pred             CCChHHHHHHHHHhc
Q 026846            6 FSLDFNLRSHMKTHS   20 (232)
Q Consensus         6 f~~~~~L~~H~~~H~   20 (232)
                      ++...-|..|...+.
T Consensus       158 Yss~ckLe~~aC~~s  172 (434)
T KOG3555|consen  158 YSSRCKLEYHACHVS  172 (434)
T ss_pred             ehhhhhHHHHhhhhh
Confidence            333344444444433


No 154
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=20.91  E-value=81  Score=19.21  Aligned_cols=11  Identities=45%  Similarity=1.238  Sum_probs=8.1

Q ss_pred             CCCccCCcccccc
Q 026846           85 ERPYACPYEGCEK   97 (232)
Q Consensus        85 ~k~~~C~~~~C~k   97 (232)
                      ..+|.|+.  ||.
T Consensus        46 ~~~Y~CP~--CGF   56 (59)
T PRK14890         46 SNPYTCPK--CGF   56 (59)
T ss_pred             CCceECCC--CCC
Confidence            46799966  984


No 155
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]
Probab=20.90  E-value=8.5  Score=35.51  Aligned_cols=23  Identities=26%  Similarity=0.574  Sum_probs=16.8

Q ss_pred             CCCCccCCcccccccccChHHHHHH
Q 026846           84 SERPYACPYEGCEKAYIHEYKLKLH  108 (232)
Q Consensus        84 ~~k~~~C~~~~C~k~f~~~~~l~~H  108 (232)
                      +-|.-+|+.  |+.+|+...-++.|
T Consensus       675 etRqRKCP~--Cn~aFganDv~~I~  697 (698)
T KOG0978|consen  675 ETRQRKCPK--CNAAFGANDVHRIH  697 (698)
T ss_pred             HHhcCCCCC--CCCCCCcccccccC
Confidence            345678966  99999988766554


No 156
>PF05477 SURF2:  Surfeit locus protein 2 (SURF2);  InterPro: IPR008833 Surfeit locus protein 2 is part of a group of at least six sequence unrelated genes (Surf-1 to Surf-6). The six Surfeit genes have been classified as housekeeping genes, being expressed in all tissue types tested and not containing a TATA box in their promoter region. The exact function of SURF2 is unknown [].
Probab=20.21  E-value=89  Score=25.11  Aligned_cols=9  Identities=11%  Similarity=0.312  Sum_probs=4.7

Q ss_pred             CCCcccCCC
Q 026846           21 QENYHICPY   29 (232)
Q Consensus        21 ~~~p~~C~~   29 (232)
                      +...++|.+
T Consensus        22 ~~~rvrC~l   30 (244)
T PF05477_consen   22 ENGRVRCTL   30 (244)
T ss_pred             CCCeEEEee
Confidence            344566654


No 157
>PF14353 CpXC:  CpXC protein
Probab=20.09  E-value=23  Score=25.07  Aligned_cols=23  Identities=30%  Similarity=0.717  Sum_probs=15.7

Q ss_pred             CccCCcccccccccChHHHHHHHHh
Q 026846           87 PYACPYEGCEKAYIHEYKLKLHLKR  111 (232)
Q Consensus        87 ~~~C~~~~C~k~f~~~~~l~~H~~~  111 (232)
                      .|.|+.  ||+.|.-...+..|-..
T Consensus        38 ~~~CP~--Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen   38 SFTCPS--CGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             EEECCC--CCCceecCCCEEEEcCC
Confidence            578876  98888766666555443


Done!