BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026849
         (232 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580
 pdb|3GCQ|A Chain A, Human P38 Map Kinase In Complex With Rl45
 pdb|3GCS|A Chain A, Human P38 Map Kinase In Complex With Sorafenib
 pdb|3GCV|A Chain A, Human P38 Map Kinase In Complex With Rl62
 pdb|3HV3|A Chain A, Human P38 Map Kinase In Complex With Rl49
 pdb|3IW5|A Chain A, Human P38 Map Kinase In Complex With An Indole Derivative
 pdb|3IW6|A Chain A, Human P38 Map Kinase In Complex With A Benzylpiperazin-
           Pyrrol
 pdb|3IW7|A Chain A, Human P38 Map Kinase In Complex With An Imidazo-Pyridine
 pdb|3IW8|A Chain A, Structure Of Inactive Human P38 Map Kinase In Complex With
           A Thiazole-Urea
 pdb|3HUB|A Chain A, Human P38 Map Kinase In Complex With Scios-469
 pdb|3L8S|A Chain A, Human P38 Map Kinase In Complex With Cp-547632
 pdb|3LFB|A Chain A, Human P38 Map Kinase In Complex With Rl98
 pdb|3LFC|A Chain A, Human P38 Map Kinase In Complex With Rl99
 pdb|3LFD|A Chain A, Human P38 Map Kinase In Complex With Rl113
 pdb|3LFE|A Chain A, Human P38 Map Kinase In Complex With Rl116
 pdb|3LFF|A Chain A, Human P38 Map Kinase In Complex With Rl166
 pdb|3PG3|A Chain A, Human P38 Map Kinase In Complex With Rl182
          Length = 360

 Score = 28.9 bits (63), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
           P  LAV   S + +L    L   T   MT  VA  +Y A ++  +W+     + + SV C
Sbjct: 153 PSNLAVNEDSELKILDF-GLCRHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 211

Query: 199 LVGIL 203
           ++  L
Sbjct: 212 IMAEL 216


>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A
           Dihydroquinolinone
 pdb|1R3C|A Chain A, The Structure Of P38alpha C162s Mutant
 pdb|2I0H|A Chain A, The Structure Of P38alpha In Complex With An
           Arylpyridazinone
 pdb|3GC7|A Chain A, The Structure Of P38alpha In Complex With A
           Dihydroquinazolinone
 pdb|3NEW|A Chain A, P38-Alpha Complexed With Compound 10
          Length = 366

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
           P  LAV   S + +L    L   T   MT  VA  +Y A ++  +W+     + + SV C
Sbjct: 159 PSNLAVNEDSELKILDF-GLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 217

Query: 199 LVGIL 203
           ++  L
Sbjct: 218 IMAEL 222


>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk
           Docking Peptide
          Length = 362

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)

Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
           P  LAV   S + +L    L   T   MT  VA  +Y A ++  +W+     + + SV C
Sbjct: 155 PSNLAVNEDSELKILDF-GLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 213

Query: 199 LVGIL 203
           ++  L
Sbjct: 214 IMAEL 218


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.136    0.398 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,289,160
Number of Sequences: 62578
Number of extensions: 158006
Number of successful extensions: 475
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 475
Number of HSP's gapped (non-prelim): 3
length of query: 232
length of database: 14,973,337
effective HSP length: 96
effective length of query: 136
effective length of database: 8,965,849
effective search space: 1219355464
effective search space used: 1219355464
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)