BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026849
(232 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580
pdb|3GCQ|A Chain A, Human P38 Map Kinase In Complex With Rl45
pdb|3GCS|A Chain A, Human P38 Map Kinase In Complex With Sorafenib
pdb|3GCV|A Chain A, Human P38 Map Kinase In Complex With Rl62
pdb|3HV3|A Chain A, Human P38 Map Kinase In Complex With Rl49
pdb|3IW5|A Chain A, Human P38 Map Kinase In Complex With An Indole Derivative
pdb|3IW6|A Chain A, Human P38 Map Kinase In Complex With A Benzylpiperazin-
Pyrrol
pdb|3IW7|A Chain A, Human P38 Map Kinase In Complex With An Imidazo-Pyridine
pdb|3IW8|A Chain A, Structure Of Inactive Human P38 Map Kinase In Complex With
A Thiazole-Urea
pdb|3HUB|A Chain A, Human P38 Map Kinase In Complex With Scios-469
pdb|3L8S|A Chain A, Human P38 Map Kinase In Complex With Cp-547632
pdb|3LFB|A Chain A, Human P38 Map Kinase In Complex With Rl98
pdb|3LFC|A Chain A, Human P38 Map Kinase In Complex With Rl99
pdb|3LFD|A Chain A, Human P38 Map Kinase In Complex With Rl113
pdb|3LFE|A Chain A, Human P38 Map Kinase In Complex With Rl116
pdb|3LFF|A Chain A, Human P38 Map Kinase In Complex With Rl166
pdb|3PG3|A Chain A, Human P38 Map Kinase In Complex With Rl182
Length = 360
Score = 28.9 bits (63), Expect = 2.7, Method: Compositional matrix adjust.
Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
P LAV S + +L L T MT VA +Y A ++ +W+ + + SV C
Sbjct: 153 PSNLAVNEDSELKILDF-GLCRHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 211
Query: 199 LVGIL 203
++ L
Sbjct: 212 IMAEL 216
>pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A
Dihydroquinolinone
pdb|1R3C|A Chain A, The Structure Of P38alpha C162s Mutant
pdb|2I0H|A Chain A, The Structure Of P38alpha In Complex With An
Arylpyridazinone
pdb|3GC7|A Chain A, The Structure Of P38alpha In Complex With A
Dihydroquinazolinone
pdb|3NEW|A Chain A, P38-Alpha Complexed With Compound 10
Length = 366
Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
P LAV S + +L L T MT VA +Y A ++ +W+ + + SV C
Sbjct: 159 PSNLAVNEDSELKILDF-GLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 217
Query: 199 LVGIL 203
++ L
Sbjct: 218 IMAEL 222
>pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk
Docking Peptide
Length = 362
Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 1/65 (1%)
Query: 139 PVFLAVGNSSSMMVLAIIVLLLSTITVMTSLVALSFYGASQLKFHWVERYDKLLVGSVLC 198
P LAV S + +L L T MT VA +Y A ++ +W+ + + SV C
Sbjct: 155 PSNLAVNEDSELKILDF-GLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGC 213
Query: 199 LVGIL 203
++ L
Sbjct: 214 IMAEL 218
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.325 0.136 0.398
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,289,160
Number of Sequences: 62578
Number of extensions: 158006
Number of successful extensions: 475
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 475
Number of HSP's gapped (non-prelim): 3
length of query: 232
length of database: 14,973,337
effective HSP length: 96
effective length of query: 136
effective length of database: 8,965,849
effective search space: 1219355464
effective search space used: 1219355464
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)