BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026862
         (232 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2OX1|A Chain A, Archaeal Dehydroquinase
 pdb|2OX1|B Chain B, Archaeal Dehydroquinase
 pdb|2OX1|C Chain C, Archaeal Dehydroquinase
 pdb|2OX1|D Chain D, Archaeal Dehydroquinase
          Length = 196

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 84  AKVLKEELLEAIAPLDRGAEATPEDQQRVEQIARKLEGVNPTKEPLKSDLLNGKWEL 140
           A+V KE++L      D G +   ++++R+E++ R  + +NP    L+SDL +  ++ 
Sbjct: 34  ARVDKEKILTCRRVSD-GGKFEGDERERIEKMKRAFDSLNPDYVDLESDLPDSAFDF 89


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.133    0.379 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,653,966
Number of Sequences: 62578
Number of extensions: 198542
Number of successful extensions: 553
Number of sequences better than 100.0: 19
Number of HSP's better than 100.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 536
Number of HSP's gapped (non-prelim): 19
length of query: 232
length of database: 14,973,337
effective HSP length: 96
effective length of query: 136
effective length of database: 8,965,849
effective search space: 1219355464
effective search space used: 1219355464
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)