Citrus Sinensis ID: 026870

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MRTVSRGMISNALRFSFSIPNILQLPISSVRTRSFGIRATKPKMGKNREEVENDNVIKSHPRVNKLQQLMHIESSGGWEKCWEEGLTPWDIGQPAPIIVHLHQSGALPKGRALVPGCGTGYDVVAMASPERYVVGLEISDIAIKKAEELSSSLPNAKFVSFLKADFFTWCPTELFDLIFDYTFFCAIEPEMRAAWAQKIKDFLKPDGELITLMFPISDHVGGPPYKVSVSE
ccccccHHHHHHHHHcccccccccccHHccccccccCECccccccccccccccccHcccccHHHHHHHHHcccccccHHHHHHccccccccccccHHHHHHHHccccccccEEEEcccccHHHHHHHcccccEEEEEccHHHHHHHHHHcccccccccEEEEEcccccccccccccEEEEccccccccHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccc
********ISNALRFSFSIPNILQLPISSVRTRSF******************************LQQLMHIESSGGWEKCWEEGLTPWDIGQPAPIIVHLHQSGALPKGRALVPGCGTGYDVVAMASPERYVVGLEISDIAIKKAEELSSSLPNAKFVSFLKADFFTWCPTELFDLIFDYTFFCAIEPEMRAAWAQKIKDFLKPDGELITLMFPISDHVG***Y******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTVSRGMISNALRFSFSIPNILQLPISSVRTRSFGIRATKPKMGKNREEVENDNVIKSHPRVNKLQQLMHIESSGGWEKCWEEGLTPWDIGQPAPIIVHLHQSGALPKGRALVPGCGTGYDVVAMASPERYVVGLEISDIAIKKAEELSSSLPNAKFVSFLKADFFTWCPTELFDLIFDYTFFCAIEPEMRAAWAQKIKDFLKPDGELITLMFPISDHVGGPPYKVSVSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Thiocyanate methyltransferase 1 S-adenosyl-L-methionine-dependent methyltransferase. Involved in glucosinolate metabolism and defense against phytopathogens. Highly reactive to thiocyanate (NCS(-)) derived from myrosinase-mediated hydrolysis of glucosinolates upon tissue damage.probableQ0WP12

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LCC, chain A
Confidence level:very confident
Coverage over the Query: 75-229
View the alignment between query and template
View the model in PyMOL
Template: 1JSX, chain A
Confidence level:confident
Coverage over the Query: 55-79,95-213
View the alignment between query and template
View the model in PyMOL