BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026892
         (231 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RG2|A Chain A, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|B Chain B, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|C Chain C, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|D Chain D, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|E Chain E, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|F Chain F, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|G Chain G, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|H Chain H, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|I Chain I, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
 pdb|3RG2|J Chain J, Structure Of A Two-Domain Nrps Fusion Protein Containing
           The Ente Adenylation Domain And Entb Aryl-Carrier
           Protein From Enterobactin Biosynthesis
          Length = 617

 Score = 29.3 bits (64), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 14/70 (20%)

Query: 168 WKGKPFP--FSKGCSFYKLEVVNGKRQITYGRDIVEPA-----------FKPGETALAAI 214
           W+  P     ++  +   + V++G+RQ++Y R++ + A            KPGETAL  +
Sbjct: 24  WQDLPLTDILTRHAASDSIAVIDGERQLSY-RELNQAADNLACSLRRQGIKPGETALVQL 82

Query: 215 GAVTWLLQQF 224
           G V  L   F
Sbjct: 83  GNVAELYITF 92


>pdb|1OHS|A Chain A, Crystal Structure Of 5-3-Ketosteroid Isomerase Mutant Y14f
           D38n From Pseudomonas Testosteroni Complexed With
           Androstanedione
 pdb|1OHS|B Chain B, Crystal Structure Of 5-3-Ketosteroid Isomerase Mutant Y14f
           D38n From Pseudomonas Testosteroni Complexed With
           Androstanedione
 pdb|1OHS|C Chain C, Crystal Structure Of 5-3-Ketosteroid Isomerase Mutant Y14f
           D38n From Pseudomonas Testosteroni Complexed With
           Androstanedione
 pdb|1OHS|D Chain D, Crystal Structure Of 5-3-Ketosteroid Isomerase Mutant Y14f
           D38n From Pseudomonas Testosteroni Complexed With
           Androstanedione
          Length = 125

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 91  RRFYAGINGRDLASVEELIADDCVYEDLIFPRPFLGRKA 129
           +RF A +N  DL  +  L ADD   E+ +   P  G  A
Sbjct: 12  QRFVAALNAGDLDGIVALFADDATVENPVGSEPRSGTAA 50


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.134    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,335,998
Number of Sequences: 62578
Number of extensions: 179561
Number of successful extensions: 335
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 334
Number of HSP's gapped (non-prelim): 3
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)