Citrus Sinensis ID: 026902

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MITGDIPPNQTIYIKNLNEKIKKEELKRSLYCLFSQYGRIFDVVALKTPKLRGQAWVVFSEVTAASNAVRQMQNFPFYDKPMRIQYAKSKSDCVAKEDGSFVPREKKKKQEEKAERKRRAEEAQQSSMANGTGAQSNGGTAASFRNANTQETAAPNNILFIQNLPHETTSSMLEMLFQQYPGFKEVRMIEAKPGIAFVEFEDDVQSSMAMQALQGFKITPQNPMAITFAKK
ccccccccccEEEEccccccccHHHHHHHHHHHHcccccEEEEECccccccccCEEEEEccHHHHHHHHHHccccccccccCEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEECccccEEEEEEccHHHHHHHHHHHcccCCcccccEEEEEEcc
******PPNQTIYIKNLNEKIKKEELKRSLYCLFSQYGRIFDVVALKTPKLRGQAWVVFSEVTAASNAVRQMQNFPFYDKPMRIQY*****************************************************TAASFRNANTQETAAPNNILFIQNLPHETTSSMLEMLFQQYPGFKEVRMIEAKPGIAFVEFEDDVQSSMAMQALQGFKITPQNPMAITFAKK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MITGDIPPNQTIYIKNLNEKIKKEELKRSLYCLFSQYGRIFDVVALKTPKLRGQAWVVFSEVTAASNAVRQMQNFPFYDKPMRIQYAKSKSDCVAKEDGSFVPxxxxxxxxxxxxxxxxxxxxxxxSMANGTGAQSNGGTAASFRNANTQETAAPNNILFIQNLPHETTSSMLEMLFQQYPGFKEVRMIEAKPGIAFVEFEDDVQSSMAMQALQGFKITPQNPMAITFAKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U2 small nuclear ribonucleoprotein B'' Involved in nuclear pre-mRNA splicing.confidentQ10MR0
U2 small nuclear ribonucleoprotein B'' Involved in nuclear pre-mRNA splicing.confidentO22922
U2 small nuclear ribonucleoprotein B'' Involved in pre-mRNA splicing. This protein is associated with snRNP U2. It binds stem loop IV of U2 snRNA only in presence of the U2A' protein.probableQ9CQI7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PGW, chain A
Confidence level:very confident
Coverage over the Query: 5-102
View the alignment between query and template
View the model in PyMOL