Citrus Sinensis ID: 026906


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MEGVGALGVSSSPTLVGKISCSRRLSYSSNKLTLRTTSHLAAFHPQSHLFVKFPPCPQRKTVARNSNETGIFLPHLVASMEQVEETYIMVKPDGVQRGLVGDIISRFEKKGFKLTGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEcccccccccHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccccccHHHHHHHHHcccEEEEEEEcccHHHHHHHHHccccccccccccccccccccccccCEEccccHHHHHHHHHccccccccccccccccccccc
***************VG********************SHLAAFHPQSHL******************ETGIFLPHLVASMEQVEETYIMVKPDGVQRGLVGDIISRFEKKGFKLTGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGVGALGVSSSPTLVGKISCSRRLSYSSNKLTLRTTSHLAAFHPQSHLFVKFPPCPQRKTVARNSNETGIFLPHLVASMEQVEETYIMVKPDGVQRGLVGDIISRFEKKGFKLTGLKLFQCPKDLAEEHYKDLNSKPFFPKLIEYITSGPVVCMAWEGAGVVASARKLIGSTDPLQAEPGTIRGDLAVQTGRNVVHGSDSPENGKREIGLWFKEGELCQWTPAQAQWLRE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside diphosphate kinase II, chloroplastic Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. May activate MPK3 and MPK6. May be involved in the regulation of cellular redox state and hydrogen peroxide-mediated MAP kinase signaling.confidentO64903
Nucleoside diphosphate kinase 2, chloroplastic Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableQ852S5
Nucleoside diphosphate kinase 2, chloroplastic Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.probableQ01402

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.6Nucleoside-diphosphate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S57, chain A
Confidence level:very confident
Coverage over the Query: 81-231
View the alignment between query and template
View the model in PyMOL
Template: 2Z14, chain A
Confidence level:probable
Coverage over the Query: 30-78
View the alignment between query and template
View the model in PyMOL