BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026909
         (231 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3OLM|A Chain A, Structure And Function Of A Ubiquitin Binding Site Within
           The Catalytic Domain Of A Hect Ubiquitin Ligase
          Length = 429

 Score = 28.5 bits (62), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)

Query: 176 YHGVGRTFFNPASAKVFSRFEALRK--AVQNYTIEATPD 212
           Y GV R FF   S ++F+ F  L +  A  NYTI+  P+
Sbjct: 116 YGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPN 154


>pdb|3SF4|A Chain A, Crystal Structure Of The Complex Between The Conserved
           Cell Polarity Proteins Inscuteable And Lgn
 pdb|3SF4|B Chain B, Crystal Structure Of The Complex Between The Conserved
           Cell Polarity Proteins Inscuteable And Lgn
 pdb|3SF4|C Chain C, Crystal Structure Of The Complex Between The Conserved
           Cell Polarity Proteins Inscuteable And Lgn
          Length = 406

 Score = 27.3 bits (59), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 20/37 (54%)

Query: 167 RKVYNLLGLYHGVGRTFFNPASAKVFSRFEALRKAVQ 203
           R +YNL  +YH  G++F  P    V    E +R A+Q
Sbjct: 128 RALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQ 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.409 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,478,018
Number of Sequences: 62578
Number of extensions: 248817
Number of successful extensions: 580
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 579
Number of HSP's gapped (non-prelim): 2
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)