BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 026909
(231 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3OLM|A Chain A, Structure And Function Of A Ubiquitin Binding Site Within
The Catalytic Domain Of A Hect Ubiquitin Ligase
Length = 429
Score = 28.5 bits (62), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 2/39 (5%)
Query: 176 YHGVGRTFFNPASAKVFSRFEALRK--AVQNYTIEATPD 212
Y GV R FF S ++F+ F L + A NYTI+ P+
Sbjct: 116 YGGVSREFFFLLSHEMFNPFYCLFEYSAYDNYTIQINPN 154
>pdb|3SF4|A Chain A, Crystal Structure Of The Complex Between The Conserved
Cell Polarity Proteins Inscuteable And Lgn
pdb|3SF4|B Chain B, Crystal Structure Of The Complex Between The Conserved
Cell Polarity Proteins Inscuteable And Lgn
pdb|3SF4|C Chain C, Crystal Structure Of The Complex Between The Conserved
Cell Polarity Proteins Inscuteable And Lgn
Length = 406
Score = 27.3 bits (59), Expect = 6.6, Method: Compositional matrix adjust.
Identities = 14/37 (37%), Positives = 20/37 (54%)
Query: 167 RKVYNLLGLYHGVGRTFFNPASAKVFSRFEALRKAVQ 203
R +YNL +YH G++F P V E +R A+Q
Sbjct: 128 RALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDALQ 164
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.322 0.135 0.409
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,478,018
Number of Sequences: 62578
Number of extensions: 248817
Number of successful extensions: 580
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 579
Number of HSP's gapped (non-prelim): 2
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)