Citrus Sinensis ID: 026912


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MILRRLAAAFPHSRRFFSSNSNHDFASAIVDLNKEMESIFGEPPTSNGFSGSVSNDFMAQEAQLTSQKICDSTPGLTHIGRTGEAQMVDVSLKENSQRTAIANCKVILGKKVFDLVLANQLAKGDVLSVAKIAGISGAKHTSSLIPLCHNITLTHVRVDLMLNSKDFSVDIEGEAVSSGKTGVEMEAMTAVTVAGLTVYDMCKAASKDIQITDVRLDRKTGGKSGDWCREK
cccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHccccccccccccccccccccEEEEEcccccccEEEEEEEEEEEEcHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccccCEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccCEEccEEEEEccccccccEECcc
*********F*******************************************************************HIGRTGEAQMVDVSLKENSQRTAIANCKVILGKKVFDLVLANQLAKGDVLSVAKIAGISGAKHTSSLIPLCHNITLTHVRVDLMLNSKDFSVDIEGEAVSSGKTGVEMEAMTAVTVAGLTVYDMCKAASKDIQITDVRLDRKTG**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILRRLAAAFPHSRRFFSSNSNHDFASAIVDLNKEMESIFGEPPTSNGFSGSVSNDFMAQEAQLTSQKICDSTPGLTHIGRTGEAQMVDVSLKENSQRTAIANCKVILGKKVFDLVLANQLAKGDVLSVAKIAGISGAKHTSSLIPLCHNITLTHVRVDLMLNSKDFSVDIEGEAVSSGKTGVEMEAMTAVTVAGLTVYDMCKAASKDIQITDVRLDRKTGGKSGDWCREK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cyclic pyranopterin monophosphate synthase accessory protein, mitochondrial Involved in molybdenum cofactor biosynthesis.probableQ39056
Cyclic pyranopterin monophosphate synthase accessory protein Together with MoaA, is involved in the conversion of a guanosine derivative (5'-GTP) into molybdopterin precursor Z.probableQ21HG1
Cyclic pyranopterin monophosphate synthase accessory protein Together with MoaA, is involved in the conversion of a guanosine derivative (5'-GTP) into molybdopterin precursor Z.probableB0TI15

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2EEY, chain A
Confidence level:very confident
Coverage over the Query: 75-230
View the alignment between query and template
View the model in PyMOL