BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026916
         (231 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj
           Protein, Mouse Hypothetical Mkiaa0962
          Length = 88

 Score = 32.0 bits (71), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 6/69 (8%)

Query: 78  SDGSTAIFPRINVRD--PYKRLGISREASEEEIQAARNFLVQKYAGHKPSIDAIESAHDK 135
           S GS+ I   ++  D  PY+ LG+SR AS+ +I+ A   L +++    P  +    A D+
Sbjct: 2   SSGSSGILQSLSALDFDPYRVLGVSRTASQADIKKAYKKLAREW---HPDKNKDPGAEDR 58

Query: 136 II-MQKFYE 143
            I + K YE
Sbjct: 59  FIQISKAYE 67


>pdb|3GQM|A Chain A, Crystal Structure Of Cell Inhibiting Factor (Cif) From
           Burkholderia Pseudomallei (Cifbp)
 pdb|3GQM|B Chain B, Crystal Structure Of Cell Inhibiting Factor (Cif) From
           Burkholderia Pseudomallei (Cifbp)
          Length = 276

 Score = 29.6 bits (65), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 20/61 (32%)

Query: 6   LIGSPSRCCLRIPVCSSGSVRRFSAFTSPGKPKDQIKIAYLERWYWAGSAQGCKKQRTYS 65
           L G      L  PVC   +   F   T    P D   I YLE   +A         + Y 
Sbjct: 90  LTGGADPFALMTPVCGLSANNIFKLMTEKDVPIDPTSIEYLENTSFAEHVNTLDSHKNYV 149

Query: 66  I 66
           +
Sbjct: 150 V 150


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.135    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,123,213
Number of Sequences: 62578
Number of extensions: 219777
Number of successful extensions: 496
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 490
Number of HSP's gapped (non-prelim): 8
length of query: 231
length of database: 14,973,337
effective HSP length: 96
effective length of query: 135
effective length of database: 8,965,849
effective search space: 1210389615
effective search space used: 1210389615
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)