BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 026922
         (231 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|A6H5Y1|MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus GN=Mphosph9 PE=2 SV=1
          Length = 991

 Score = 35.8 bits (81), Expect = 0.28,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 25  RLSVLPVKCLSSRQSRDSDSDSDLRTTPSPSSTSGFSPY 63
           R+S  P   L    SR SD+DS  + + +PS  SGFS Y
Sbjct: 279 RISFSPDSVLEPSLSRHSDTDSSSQASHNPSQVSGFSKY 317


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.324    0.138    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 80,312,339
Number of Sequences: 539616
Number of extensions: 3155777
Number of successful extensions: 10334
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 10333
Number of HSP's gapped (non-prelim): 8
length of query: 231
length of database: 191,569,459
effective HSP length: 114
effective length of query: 117
effective length of database: 130,053,235
effective search space: 15216228495
effective search space used: 15216228495
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.5 bits)
S2: 59 (27.3 bits)