Citrus Sinensis ID: 026929


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MSLTIPTNLSKPLLKPRSNSQLSHAKLSKQMITCSSSAGSEETSSSSGKAAKPLQAFSAALALSSILLSAPQPAVADISGLTPCKESKQFAKREKQQLKKLESSLKLYAPDSAPALAIKATMEKTKRRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGLLFLYIAGWIGWVGRSYLIAISGEKKPAMKEIIIDVPLASRLVFRGFSWPVAAYREFVNGELVVKDV
ccccccccccccccccccccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcHHHHHHHHHHHcccccccccccccCEECccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccEEEECHHHHHHHHHcccccHHHHHHHHHccCCccccc
**LTI***********************************************PLQAFSAALALSSILLSAPQPAVADISGLTPCKESKQFAKREK************YAPDSAPALAIKATMEKTKRRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGLLFLYIAGWIGWVGRSYLIAISGEKKPAMKEIIIDVPLASRLVFRGFSWPVAAYREFVNGELVV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLTIPTNLSKPLLKPRSNSQLSHAKLSKQMITCSSSAGSEETSSSSGKAAKPLQAFSAALALSSILLSAPQPAVADISGLTPCKESKQFAKREKQQLKKLESSLKLYAPDSAPALAIKATMEKTKRRFDNYGKYGLLCGSDGLPHLIVSGDQRHWGEFITPGLLFLYIAGWIGWVGRSYLIAISGEKKPAMKEIIIDVPLASRLVFRGFSWPVAAYREFVNGELVVKDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Photosystem I reaction center subunit III, chloroplastic Participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI.confidentQ9SHE8
Photosystem I reaction center subunit III, chloroplastic Probably participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI.probableP46486
Photosystem I reaction center subunit III, chloroplastic Probably participates in efficiency of electron transfer from plastocyanin to P700 (or cytochrome c553 in algae and cyanobacteria). This plastocyanin-docking protein contributes to the specific association of plastocyanin to PSI.probableP12355

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain F
Confidence level:very confident
Coverage over the Query: 77-230
View the alignment between query and template
View the model in PyMOL