Citrus Sinensis ID: 026941


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MPLRGFHLIHNEIKKPNQTKQIKLSFFIFLFLFIYINHTITQLSIDFDFSNDSILLSLQGMQSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGATSVRCSCCHTVNLAPAPNQFAHIICGHCRTTLMYPHGAPSVKCAVCQYVTNVNMANARVPLPANRPNGTAIPGTLPSTSMTQTVVVENPMSVDESGKLVSNVVVGVSTEKK
ccccccccccccccccccccccEEEHHHHHHHHHHHHHHccccccccccccccccccccccccEEEcccccccEEccccccEEEcccccccccccccccccEEEEEcccccEEEEcccccEEEcccccccccccccccccEEEccccccEEEEcccccCEEcccccEEEECcccccccccccccccccccccccccccccEEEEEEccccccccccEEEEEEEEEEEccc
**LRGFHLIHNEIKKPNQTKQIKLSFFIFLFLFIYINHTITQLSIDFDFSNDSILLSLQGMQSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGATSVRCSCCHTVNLAPAPNQFAHIICGHCRTTLMYPHGAPSVKCAVCQYVTNVN*******************************VVENPMSVDESGKLVSNVVVGVST***
xxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPLRGFHLIHNEIKKPNQTKQIKLSFFIFLFLFIYINHTITQLSIDFDFSNDSILLSLQGMQSQLVCSGCRSVLLYPRGATNVCCALCNTITSVPIPGMEMAQLICGGCRTLLMYTRGATSVRCSCCHTVNLAPAPNQFAHIICGHCRTTLMYPHGAPSVKCAVCQYVTNVNMANARVPLPANRPNGTAIPGTLPSTSMTQTVVVENPMSVDESGKLVSNVVVGVSTEKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein LSD1 Negative regulator of reactive oxygen-induced cell death, cold stress-induced cell death, pathogen-induced hypersensitive response (HR), basal disease resistance. May be involved in the induction of the copper/zinc superoxide dismutase CSD1 and CSD2 that detoxify accumulating superoxide before the reactive oxygen species (ROS) can trigger a cell death cascade. LSD1 and LOL1 have antagonistic effects on CSD1 and CSD2 accumulation to regulate oxidative stress-induced cell death. Antagonizes the function of BZIP10, a positive regulator of cell death, by interacting in the cytoplasm and preventing its nuclear localization. Controls lysigenous aerenchyma in hypocotyls under root hypoxia. Required for leaf acclimation in response to excess excitation energy.probableP94077
Protein LOL3 Putative zinc finger that may be involved in programmed cell death and defense response.probableQ6ASS2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QXF, chain A
Confidence level:probable
Coverage over the Query: 121-160
View the alignment between query and template
View the model in PyMOL
Template: 2XZM, chain 6
Confidence level:probable
Coverage over the Query: 82-121
View the alignment between query and template
View the model in PyMOL