Citrus Sinensis ID: 026966

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MAKSSKKLTPRLRKLSVYLYIPNIIGYARVLLNCYAFGVCFSNKWLFSVLYFISFVCDAIDGWCARKFNQVSTFGAVLDMVTDRISTASLLAILSQVYRPGLVFVSLLALDIGSHWLQMYSTFLTGKTSHKDVKDSTNWLFKAYYGNRIFMGYCCVACEVLYLILFLIVDTQSESLVDVVGSSLQQGSLLSILVALSLFGWAIKQVVNVIQMKTAADVCVHYDIEKKQKP
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*************KLSVYLYIPNIIGYARVLLNCYAFGVCFSNKWLFSVLYFISFVCDAIDGWCARKFNQVSTFGAVLDMVTDRISTASLLAILSQVYRPGLVFVSLLALDIGSHWLQMYSTFLTGKTSHKDVKDSTNWLFKAYYGNRIFMGYCCVACEVLYLILFLIVDTQSESLVDVVGSSLQQGSLLSILVALSLFGWAIKQVVNVIQMKTAADVCVHYDIE*****
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKSSKKLTPRLRKLSVYLYIPNIIGYARVLLNCYAFGVCFSNKWLFSVLYFISFVCDAIDGWCARKFNQVSTFGAVLDMVTDRISTASLLAILSQVYRPGLVFVSLLALDIGSHWLQMYSTFLTGKTSHKDVKDSTNWLFKAYYGNRIFMGYCCVACEVLYLILFLIVDTQSESLVDVVGSSLQQGSLLSILVALSLFGWAIKQVVNVIQMKTAADVCVHYDIEKKQKP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CDP-diacylglycerol--inositol 3-phosphatidyltransferase 1 Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.confidentQ8LBA6
CDP-diacylglycerol--inositol 3-phosphatidyltransferase probableP06197
CDP-diacylglycerol--inositol 3-phosphatidyltransferase Catalyzes the biosynthesis of phosphatidylinositol (PtdIns) as well as PtdIns:inositol exchange reaction. May thus act to reduce an excessive cellular PtdIns content. The exchange activity is due to the reverse reaction of PtdIns synthase and is dependent on CMP, which is tightly bound to the enzyme.probableQ8VDP6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.8.-Transferases for other substituted phosphate groups.probable
2.7.8.11CDP-diacylglycerol--inositol 3-phosphatidyltransferase.probable

Spatial Structural Prediction

No confident structure templates for the query are predicted