Citrus Sinensis ID: 026967


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MGNRFICMNKKEAKENNNGSRSKRMGRSQRKMLAEEEFLHRQALSMALQQHQLSQRFEGSMSRRIGGNTSSRRRTLSESLSNGKQDTNILENIQYKKFVLIHGEGFGAWCWYKTVASLEEVGLIPTALDLKGSGIDLSDTNSVTTLAEYSKPLLDYLENLLEDEKVILVGHSSGGACVSYALEHFPQKISKAIFLCATMVSDGQRPFDVFAEEVCLMLNAPLISLVTVEE
cccccEEEcccccccccccccccccccHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccHHHHHHHHcccccEEEccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHccccccEEEEEEccccccccccccccHHHHHHHHcccccccccccc
***************************************************************************************NILENIQYKKFVLIHGEGFGAWCWYKTVASLEEVGLIPTALDLKGSGIDLSDTNSVTTLAEYSKPLLDYLENLLEDEKVILVGHSSGGACVSYALEHFPQKISKAIFLCATMVSDGQRPFDVFAEEVCLMLNAPLISLVTVE*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNRFICMNKKEAKENNNGSRSKRMGRSQRKMLAEEEFLHRQALSMALQQHQLSQRFEGSMSRRIGGNTSSRRRTLSESLSNGKQDTNILENIQYKKFVLIHGEGFGAWCWYKTVASLEEVGLIPTALDLKGSGIDLSDTNSVTTLAEYSKPLLDYLENLLEDEKVILVGHSSGGACVSYALEHFPQKISKAIFLCATMVSDGQRPFDVFAEEVCLMLNAPLISLVTVEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative methylesterase 12, chloroplastic Putative methylesterase.probableQ940H7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3STY, chain A
Confidence level:very confident
Coverage over the Query: 93-208
View the alignment between query and template
View the model in PyMOL
Template: 1MPX, chain A
Confidence level:confident
Coverage over the Query: 73-198
View the alignment between query and template
View the model in PyMOL