Query         026981
Match_columns 230
No_of_seqs    98 out of 110
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 03:18:35 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/026981.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/026981hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02234 CDI:  Cyclin-dependent  99.7 3.9E-18 8.4E-23  119.8   1.4   45  185-229     6-51  (51)
  2 KOG4743 Cyclin-dependent kinas  98.4 4.4E-07 9.4E-12   79.6   5.0   45  185-229    26-72  (195)
  3 TIGR01878 cas_Csa5 CRISPR-asso  49.0      22 0.00048   28.8   3.3   22  181-202    61-82  (97)
  4 PF09702 Cas_Csa5:  CRISPR-asso  38.9      34 0.00074   28.1   3.0   22  180-201    68-89  (105)
  5 PF07583 PSCyt2:  Protein of un  32.8      30 0.00066   30.6   2.0   25  173-197    28-52  (208)
  6 PF04244 DPRP:  Deoxyribodipyri  24.5      25 0.00055   31.3   0.1   18  207-224   171-188 (224)
  7 PF13169 Poxvirus_B22R_N:  Poxv  15.4 1.4E+02   0.003   23.6   2.4   23  191-213    32-54  (92)
  8 PF12983 DUF3867:  Protein of u  15.2      90  0.0019   28.0   1.4   15  200-214    62-76  (186)
  9 cd08002 WGR_PARP3_like WGR dom  13.8 3.1E+02  0.0067   21.5   4.0   15  215-229    85-99  (100)
 10 PF05689 DUF823:  Salmonella re  13.4 1.2E+02  0.0026   26.1   1.7   24   10-33      1-26  (184)

No 1  
>PF02234 CDI:  Cyclin-dependent kinase inhibitor;  InterPro: IPR003175 Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase.; GO: 0004861 cyclin-dependent protein kinase inhibitor activity, 0007050 cell cycle arrest, 0005634 nucleus; PDB: 1H27_E 1JSU_C.
Probab=99.69  E-value=3.9e-18  Score=119.82  Aligned_cols=45  Identities=47%  Similarity=1.047  Sum_probs=38.8

Q ss_pred             CC-hHHHHHHHHHHHHHHHHHHhhhhCCCCCCCCCCCCccceeecC
Q 026981          185 PT-AHEMDKFFADTEEEQQRQFIEKYNYDPVNDKPLPGHFKWQKVD  229 (230)
Q Consensus       185 Pt-~~E~eeFFa~aE~~~~~rF~~KyNfD~~~d~PL~GRyEW~~~~  229 (230)
                      |+ .+||+.||++++++++++|++||||||++|+||+|||+|++|+
T Consensus         6 p~d~~e~~~~~~~~l~~~~e~~~~kWNFDF~~~~PL~GryeWe~v~   51 (51)
T PF02234_consen    6 PVDHEELERFFQEELQEQREEFSEKWNFDFVNDTPLPGRYEWERVD   51 (51)
T ss_dssp             ---HHHHHHHHHHHHTTTTHHHHHHHTEETTTTEE-SSSS--EEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCccCCCCeEeEeCC
Confidence            66 7999999999999999999999999999999999999999984


No 2  
>KOG4743 consensus Cyclin-dependent kinase inhibitor [Signal transduction mechanisms]
Probab=98.37  E-value=4.4e-07  Score=79.65  Aligned_cols=45  Identities=22%  Similarity=0.483  Sum_probs=36.9

Q ss_pred             CChHHHHHHHHHHHHHHHHHHhhhhCCCCCCCCCCCC--ccceeecC
Q 026981          185 PTAHEMDKFFADTEEEQQRQFIEKYNYDPVNDKPLPG--HFKWQKVD  229 (230)
Q Consensus       185 Pt~~E~eeFFa~aE~~~~~rF~~KyNfD~~~d~PL~G--RyEW~~~~  229 (230)
                      |..+|+---|.+.=+..++.-++||||||..|+||+|  +|+|..|+
T Consensus        26 vd~EElSR~l~s~l~~m~~e~~~KWnFDFq~~~PL~g~g~y~we~V~   72 (195)
T KOG4743|consen   26 VDHEELSRDLNSRLERMNEEDQQKWNFDFQQGTPLEGSGDYEWEEVS   72 (195)
T ss_pred             CCHHHHhHHHHHHHHHHHHHHHhccCcccccCCcccCCCCceeEEcc
Confidence            3556666667777667777788999999999999977  99999885


No 3  
>TIGR01878 cas_Csa5 CRISPR-associated protein, Csa5 family. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model represents a minor family of Cas protein found in the (all archaeal) APERN subtype of CRISPR/Cas locus, so the family is designated Csa5, for CRISPR/Cas Subtype Protein 5.
Probab=49.00  E-value=22  Score=28.77  Aligned_cols=22  Identities=27%  Similarity=0.628  Sum_probs=19.4

Q ss_pred             CCCCCChHHHHHHHHHHHHHHH
Q 026981          181 CSLIPTAHEMDKFFADTEEEQQ  202 (230)
Q Consensus       181 ~~~~Pt~~E~eeFFa~aE~~~~  202 (230)
                      .+.+|+++|||.||..++++..
T Consensus        61 ~~~lptdeeVe~f~r~~~~di~   82 (97)
T TIGR01878        61 VGYLPTDKEVEDFLRDVREDIR   82 (97)
T ss_pred             cCCCCcHHHHHHHHHHhHHHHH
Confidence            4589999999999999998874


No 4  
>PF09702 Cas_Csa5:  CRISPR-associated protein (Cas_Csa5);  InterPro: IPR010157 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a minor family of Cas protein found in various species of Sulfolobus and Pyrococcus (all archaeal). It is found with two different CRISPR loci in Sulfolobus solfataricus.
Probab=38.91  E-value=34  Score=28.08  Aligned_cols=22  Identities=27%  Similarity=0.594  Sum_probs=19.8

Q ss_pred             cCCCCCChHHHHHHHHHHHHHH
Q 026981          180 ACSLIPTAHEMDKFFADTEEEQ  201 (230)
Q Consensus       180 ~~~~~Pt~~E~eeFFa~aE~~~  201 (230)
                      ..+.+|+.+|+|.|....|.++
T Consensus        68 ~~g~lPt~~eVe~Fl~~v~~di   89 (105)
T PF09702_consen   68 IVGYLPTDEEVEDFLDDVERDI   89 (105)
T ss_pred             ecCCCCChHHHHHHHHHHHHHH
Confidence            3578999999999999999987


No 5  
>PF07583 PSCyt2:  Protein of unknown function (DUF1549);  InterPro: IPR011444 The function is not known. It is found associated with IPR022655 from INTERPRO. It is also found associated with the Planctomycete cytochrome C domain IPR011429 from INTERPRO.
Probab=32.83  E-value=30  Score=30.62  Aligned_cols=25  Identities=32%  Similarity=0.473  Sum_probs=21.2

Q ss_pred             hhhhhcccCCCCCChHHHHHHHHHH
Q 026981          173 NREAQISACSLIPTAHEMDKFFADT  197 (230)
Q Consensus       173 ~~r~~~~~~~~~Pt~~E~eeFFa~a  197 (230)
                      -||+..-..+.+||.+|+++|.+.-
T Consensus        28 lRRv~LDL~G~~PT~eEv~~Fl~d~   52 (208)
T PF07583_consen   28 LRRVYLDLTGLPPTPEEVRAFLADP   52 (208)
T ss_pred             HHHHHHHHhCCCcCHHHHHHHHhCC
Confidence            4667777789999999999999754


No 6  
>PF04244 DPRP:  Deoxyribodipyrimidine photo-lyase-related protein;  InterPro: IPR007357 This family appears to be related to DNA photolyases.; PDB: 3ZXS_A.
Probab=24.49  E-value=25  Score=31.28  Aligned_cols=18  Identities=39%  Similarity=0.632  Sum_probs=7.2

Q ss_pred             hhhCCCCCCCCCCCCccc
Q 026981          207 EKYNYDPVNDKPLPGHFK  224 (230)
Q Consensus       207 ~KyNfD~~~d~PL~GRyE  224 (230)
                      -|||||..|-.|+|+-..
T Consensus       171 GkWnfD~eNRk~~p~~~~  188 (224)
T PF04244_consen  171 GKWNFDAENRKKLPKGIP  188 (224)
T ss_dssp             GSS--GGGS-------TT
T ss_pred             CcCCCChhhccCCCCCCC
Confidence            399999999999987653


No 7  
>PF13169 Poxvirus_B22R_N:  Poxvirus B22R protein N-terminal
Probab=15.41  E-value=1.4e+02  Score=23.64  Aligned_cols=23  Identities=17%  Similarity=0.442  Sum_probs=20.4

Q ss_pred             HHHHHHHHHHHHHHHhhhhCCCC
Q 026981          191 DKFFADTEEEQQRQFIEKYNYDP  213 (230)
Q Consensus       191 eeFFa~aE~~~~~rF~~KyNfD~  213 (230)
                      =.+|.-|++.++.+|..+.|++.
T Consensus        32 ~kyl~i~~~~E~~~l~~~fnWt~   54 (92)
T PF13169_consen   32 YKYLDIAEKREKERLESKFNWTS   54 (92)
T ss_pred             HHHHHHHHHHHHHHHHhcCChHH
Confidence            46899999999999999999874


No 8  
>PF12983 DUF3867:  Protein of unknown function (DUF3867);  InterPro: IPR024218 This entry represents a family of functionally uncharacterised proteins that are found in bacteria. Proteins in this family are approximately 190 amino acids in length.
Probab=15.21  E-value=90  Score=27.95  Aligned_cols=15  Identities=40%  Similarity=1.028  Sum_probs=13.0

Q ss_pred             HHHHHHhhhhCCCCC
Q 026981          200 EQQRQFIEKYNYDPV  214 (230)
Q Consensus       200 ~~~~rF~~KyNfD~~  214 (230)
                      .+|+.|.++|-||+.
T Consensus        62 niQkk~mERYGfd~~   76 (186)
T PF12983_consen   62 NIQKKFMERYGFDPS   76 (186)
T ss_pred             HHHHHHHHHhCCCHH
Confidence            479999999999964


No 9  
>cd08002 WGR_PARP3_like WGR domain of poly(ADP-ribose) polymerase 3 and similar proteins. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins. Higher eukaryotes contain several PARPs and and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. This subfamily is composed of human PARP-3 and similar proteins, including Arabidopsis thaliana PARP-
Probab=13.76  E-value=3.1e+02  Score=21.54  Aligned_cols=15  Identities=33%  Similarity=0.627  Sum_probs=12.2

Q ss_pred             CCCCCCCccceeecC
Q 026981          215 NDKPLPGHFKWQKVD  229 (230)
Q Consensus       215 ~d~PL~GRyEW~~~~  229 (230)
                      +..|.||+|-|+.++
T Consensus        85 ~f~k~~gky~~ie~d   99 (100)
T cd08002          85 NFVPHPGKYTLIEMD   99 (100)
T ss_pred             CCCcCCCcceEEEec
Confidence            345889999999876


No 10 
>PF05689 DUF823:  Salmonella repeat of unknown function (DUF823);  InterPro: IPR008541 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli. These repeats are almost always found with IPR008542 from INTERPRO. The repeats are associated with RatA and RatB, the coding sequences of which are found in the pathogeneicity island of Salmonella. The sequences may be determinants of pathogenicity [, ].
Probab=13.37  E-value=1.2e+02  Score=26.12  Aligned_cols=24  Identities=29%  Similarity=0.386  Sum_probs=18.9

Q ss_pred             cccCc--eeEeeeccCCCcccchhhh
Q 026981           10 TAAGE--VAVMEVTQSSPLGVRTRAK   33 (230)
Q Consensus        10 ~~~ge--Vavmevsq~~~lGVRTRar   33 (230)
                      |+||+  .+.+.|+|...+||+|-=.
T Consensus         1 G~T~~~G~~~~~vtq~~~~G~kT~l~   26 (184)
T PF05689_consen    1 GVTGADGTATFTVTQPNGPGLKTPLT   26 (184)
T ss_pred             CccCCCCcEEEEEEcCCCCCEeeeEE
Confidence            45666  7889999977899999654


Done!