Citrus Sinensis ID: 026998


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MGGIVGKPESATSTWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSRMGMPKLEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESGEGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTRWCGVGENEDEEEGEEKN
cccccccccHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHcccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccHHHHHHHHcccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccHHHccccc
*GGIVGKPES**************************TALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAK*RMGMPKLEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESGEGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTR*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGIVGKPESATSTWMPETKLEAKMVEAMQRRAAEGTALKSFNSIILKFPKIDDSLRNCKAIFEKFDEDSNGTIDHEELKKCFHKLEIKFTEEEINDLFEACDINKDMGMKFNEFIVLLCLVYLLKDDPTALRAKSRMGMPKLEATFETLVDAFVFLDKNKDGYVSRSEMTQAVTESGEGSTGRIAIKRFEEMDWDKNGMVNFKEFLFAFTRWCGVGENEDEEEGEEKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable calcium-binding protein CML21 Potential calcium sensor.confidentQ52K82

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HPS, chain A
Confidence level:very confident
Coverage over the Query: 54-124,143-219
View the alignment between query and template
View the model in PyMOL
Template: 3Q5I, chain A
Confidence level:very confident
Coverage over the Query: 4-125,145-214
View the alignment between query and template
View the model in PyMOL