Citrus Sinensis ID: 027008

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MMLQLQCLSSQTLNPKLCPFHSLSNSKGNGFGSISVTESTSIKKKKLYVKCRQSEYYEQKSFSASPSNSSYAPTDVAVGTLPTRVYVGHSIYKGKAALTVEPRGPEFVSLDSGAVKLSREGFVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSLVALGARESCEFFHDPFKGKSEEGKVRKVLKVEPLPDGSGHFFNLSVQNKLINLDESIYIPVTRAEYTVLVSAFNV
cccccccccccccccccccccccccccccccccCEECcccccccccEEEEEccccccccccccccccccccccccccccccccCEEECcEEECccEEEEEEEccccEEEcccccEEEEEEcEEEEEEccccccccccccccEEEEEEHHHHHHHHHHcccccEEEEEcccccccccccCEEEEEEEEcccccccEEEEEEEEcccccccEEEEEEcHHHHHHHHHHHcc
********************************************KKLYVKC*Q****************************PTRVYVGHSIYKGKAALTVEPRGPEFVSLDSGAVKLSREGFVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSLVALGARESCEFFHDPFK*******VRKVLKVEPLPDGSGHFFNLSVQNKLINLDESIYIPVTRAEYTVLVSAFNV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMLQLQCLSSQTLNPKLCPFHSLSNSKGNGFGSISVTESTSIKKKKLYVKCRQSEYYEQKSFSASPSNSSYAPTDVAVGTLPTRVYVGHSIYKGKAALTVEPRGPEFVSLDSGAVKLSREGFVMLQFAPAAGVRQYDWSRKQVFSLSVTEIGSLVALGARESCEFFHDPFKGKSEEGKVRKVLKVEPLPDGSGHFFNLSVQNKLINLDESIYIPVTRAEYTVLVSAFNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Single-stranded DNA-binding protein WHY1, chloroplastic Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo.probableQ9M9S3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1L3A, chain A
Confidence level:very confident
Coverage over the Query: 82-229
View the alignment between query and template
View the model in PyMOL