Citrus Sinensis ID: 027010


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MASSFGESTSRSAQNPYSNNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
cccccccccccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccccccccccccccccccccEEEEEEHccccccEEEcccccccHHHHHHHHHccccccccccEEEEEccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
massfgestsrsaqnpysnnnsnseagnfecnicfdlaqdpivtlcghlfcwpclykwlhghsnyrecpvckatieeeklvplygrgksstdprsksipgvnipnrptgqrpetapppepshfqhqhgfgfmgglggfapmaaarfgNFTLsaafgglipplfnlqvhgfpdptmygpaasfpygftnsfhgghahgypqhtgqgqqDYYLKRLLLFIGFCVLLVLIWQ
massfgestsrsaqnpysnnnsnSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIeeeklvplygrgksstdprsksipgvnipnrptGQRPETAPPPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
MASSFGESTSRSAQNPYSNNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPEPSHfqhqhgfgfmgglggfapmaaaRFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
***************************NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLY*****************************************QHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIW*
*******************************NICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYG******************************************GFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFT************************KRLLLFIGFCVLLVLIWQ
**********************NSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGR*********KSIPGVNIPNRP***************FQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
*************************AGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGRG**********************************HFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHo
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHi
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHi
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSFGESTSRSAQNPYSNNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query229 2.2.26 [Sep-21-2011]
Q09463235 RING finger protein 5 OS= yes no 0.458 0.446 0.5 3e-27
O64425249 E3 ubiquitin-protein liga no no 0.868 0.799 0.298 2e-26
Q91YT2192 E3 ubiquitin-protein liga yes no 0.458 0.546 0.487 7e-26
Q5ZIR9194 E3 ubiquitin-protein liga yes no 0.388 0.458 0.525 1e-24
Q568Y3192 E3 ubiquitin-protein liga yes no 0.379 0.453 0.531 1e-24
Q96GF1192 E3 ubiquitin-protein liga yes no 0.379 0.453 0.531 1e-24
Q5RFK9192 E3 ubiquitin-protein liga yes no 0.379 0.453 0.531 2e-24
Q6PC78194 E3 ubiquitin-protein liga no no 0.659 0.778 0.374 5e-24
Q5M807180 E3 ubiquitin-protein liga no no 0.497 0.633 0.454 1e-23
O35445180 E3 ubiquitin-protein liga no no 0.497 0.633 0.454 1e-23
>sp|Q09463|RNF5_CAEEL RING finger protein 5 OS=Caenorhabditis elegans GN=rnf-5 PE=1 SV=1 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 9/114 (7%)

Query: 6   GESTSRSAQNPYSNNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNY 65
              T   ++ P S++N + E+  FECNIC D A+D +V+LCGHLFCWPCL +WL    N 
Sbjct: 2   ASETKAPSEEPTSSSNKD-ESARFECNICLDAAKDAVVSLCGHLFCWPCLSQWLDTRPNN 60

Query: 66  RECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPE 119
           + CPVCK+ I+  K+VP+YGRG  S+DPR K      +P RP GQR E  PPP+
Sbjct: 61  QVCPVCKSAIDGNKVVPIYGRGGDSSDPRKK------VPPRPKGQRSE--PPPQ 106





Caenorhabditis elegans (taxid: 6239)
>sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 Back     alignment and function description
>sp|Q91YT2|RN185_MOUSE E3 ubiquitin-protein ligase RNF185 OS=Mus musculus GN=Rnf185 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZIR9|RN185_CHICK E3 ubiquitin-protein ligase RNF185 OS=Gallus gallus GN=RNF185 PE=2 SV=1 Back     alignment and function description
>sp|Q568Y3|RN185_RAT E3 ubiquitin-protein ligase RNF185 OS=Rattus norvegicus GN=Rnf185 PE=2 SV=1 Back     alignment and function description
>sp|Q96GF1|RN185_HUMAN E3 ubiquitin-protein ligase RNF185 OS=Homo sapiens GN=RNF185 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFK9|RN185_PONAB E3 ubiquitin-protein ligase RNF185 OS=Pongo abelii GN=RNF185 PE=2 SV=1 Back     alignment and function description
>sp|Q6PC78|RN185_DANRE E3 ubiquitin-protein ligase RNF185 OS=Danio rerio GN=rnf185 PE=2 SV=1 Back     alignment and function description
>sp|Q5M807|RNF5_RAT E3 ubiquitin-protein ligase RNF5 OS=Rattus norvegicus GN=Rnf5 PE=2 SV=1 Back     alignment and function description
>sp|O35445|RNF5_MOUSE E3 ubiquitin-protein ligase RNF5 OS=Mus musculus GN=Rnf5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
224067343227 predicted protein [Populus trichocarpa] 0.986 0.995 0.839 1e-97
224136590228 predicted protein [Populus trichocarpa] 0.991 0.995 0.808 2e-95
255538544229 rnf5, putative [Ricinus communis] gi|223 0.991 0.991 0.852 4e-92
147851991232 hypothetical protein VITISV_043720 [Viti 0.991 0.978 0.801 9e-91
388492344228 unknown [Lotus japonicus] gi|388493550|g 0.995 1.0 0.790 3e-90
356519062231 PREDICTED: E3 ubiquitin-protein ligase R 0.995 0.987 0.775 3e-88
255632464231 unknown [Glycine max] 0.995 0.987 0.771 3e-87
388548524236 C3HC4 transcription factor [Gossypium hi 0.995 0.966 0.738 1e-84
449470015230 PREDICTED: RING finger protein 5-like [C 0.995 0.991 0.744 1e-82
356510276231 PREDICTED: E3 ubiquitin-protein ligase R 0.995 0.987 0.767 7e-77
>gi|224067343|ref|XP_002302470.1| predicted protein [Populus trichocarpa] gi|222844196|gb|EEE81743.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 193/230 (83%), Positives = 202/230 (87%), Gaps = 4/230 (1%)

Query: 1   MASSFGESTSRSAQNP-YSNNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWL 59
           MAS FGESTSR+  N  +++NN N +AGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWL
Sbjct: 1   MASGFGESTSRAPHNSSFTSNNGNGDAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWL 60

Query: 60  HGHSNYRECPVCKATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPE 119
           H HS  RECPVCKA +EEEKLVPLYGRGK+STDPRSKSIPGVNIPNRP GQRPETAPPPE
Sbjct: 61  HFHSKSRECPVCKALVEEEKLVPLYGRGKTSTDPRSKSIPGVNIPNRPAGQRPETAPPPE 120

Query: 120 PSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPA 179
           P+HF  QHGFGFMGGLGGFAPMA AR GNFT SAAFGGLIP LFNLQVHGFPD  MYGPA
Sbjct: 121 PNHFG-QHGFGFMGGLGGFAPMATARLGNFTFSAAFGGLIPSLFNLQVHGFPDAAMYGPA 179

Query: 180 ASFPYGFTNSFHGGHAHGYPQHTGQGQQDYYLKRLLLFIGFCVLLVLIWQ 229
             +PYGF NSFHGGH HGY QH GQGQQDYYLKRLLLFIGFCV L LIWQ
Sbjct: 180 G-YPYGF-NSFHGGHPHGYRQHHGQGQQDYYLKRLLLFIGFCVFLALIWQ 227




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224136590|ref|XP_002326898.1| predicted protein [Populus trichocarpa] gi|222835213|gb|EEE73648.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255538544|ref|XP_002510337.1| rnf5, putative [Ricinus communis] gi|223551038|gb|EEF52524.1| rnf5, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147851991|emb|CAN79067.1| hypothetical protein VITISV_043720 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388492344|gb|AFK34238.1| unknown [Lotus japonicus] gi|388493550|gb|AFK34841.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|356519062|ref|XP_003528193.1| PREDICTED: E3 ubiquitin-protein ligase RMA1 isoform 1 [Glycine max] gi|356519064|ref|XP_003528194.1| PREDICTED: E3 ubiquitin-protein ligase RMA1 isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255632464|gb|ACU16582.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|388548524|gb|AFK65745.1| C3HC4 transcription factor [Gossypium hirsutum] Back     alignment and taxonomy information
>gi|449470015|ref|XP_004152714.1| PREDICTED: RING finger protein 5-like [Cucumis sativus] gi|449496045|ref|XP_004160021.1| PREDICTED: RING finger protein 5-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356510276|ref|XP_003523865.1| PREDICTED: E3 ubiquitin-protein ligase RMA1H1-like isoform 1 [Glycine max] gi|356510278|ref|XP_003523866.1| PREDICTED: E3 ubiquitin-protein ligase RMA1H1-like isoform 2 [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query229
TAIR|locus:2016437226 AT1G19310 [Arabidopsis thalian 0.895 0.907 0.649 2.5e-74
TAIR|locus:2049023227 AT2G23780 [Arabidopsis thalian 0.960 0.969 0.546 1.9e-67
TAIR|locus:2037294137 AT1G74990 [Arabidopsis thalian 0.427 0.715 0.642 3.6e-34
MGI|MGI:1922078192 Rnf185 "ring finger protein 18 0.462 0.552 0.495 3e-31
RGD|1564777192 Rnf185 "ring finger protein 18 0.462 0.552 0.495 3e-31
ZFIN|ZDB-GENE-040426-1977194 rnf185 "ring finger protein 18 0.462 0.546 0.482 3e-31
UNIPROTKB|Q5ZIR9194 RNF185 "E3 ubiquitin-protein l 0.454 0.536 0.495 3.8e-31
UNIPROTKB|F1PCX5192 RNF185 "Uncharacterized protei 0.462 0.552 0.495 6.1e-31
UNIPROTKB|Q96GF1192 RNF185 "E3 ubiquitin-protein l 0.462 0.552 0.495 6.1e-31
UNIPROTKB|F2Z4Y3192 RNF185 "Uncharacterized protei 0.462 0.552 0.495 6.1e-31
TAIR|locus:2016437 AT1G19310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 750 (269.1 bits), Expect = 2.5e-74, P = 2.5e-74
 Identities = 137/211 (64%), Positives = 160/211 (75%)

Query:    19 NNNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEE 78
             N+ +N+++ NFECNIC DLAQDPIVTLCGHLFCWPCLYKWLH HS  ++CPVCKA IEE+
Sbjct:    11 NDTNNNDSSNFECNICLDLAQDPIVTLCGHLFCWPCLYKWLHLHSQSKDCPVCKAVIEED 70

Query:    79 KLVPLYGRGKSSTDPRSKSIPGVNIPNRPTGQRPETAPPPEPSHXXXXXXXXXXXXXXXX 138
             +LVPLYGRGKSS DPRSKSIPG+ +PNRP+GQRPETA PP+P+H                
Sbjct:    71 RLVPLYGRGKSSADPRSKSIPGLEVPNRPSGQRPETAQPPDPNHGFAHHHGFGGFMGGFA 130

Query:   139 XXXXXXRFGNFTLSAAFGGLIPPLFNLQVHGFPDPTMYGPAAS--FPYGFTNSFHGGHAH 196
                   RFGN TLSAAFGGLIP LFNL  HGFPD  MYG AAS  FP+GF+N FHGGH+H
Sbjct:   131 APMASARFGNVTLSAAFGGLIPSLFNLHFHGFPDAAMYGAAASGGFPHGFSNPFHGGHSH 190

Query:   197 --GYPQHTG-QGQQDYYLKRLLLFIGFCVLL 224
                Y +HTG QGQQD++L R+LL I F V++
Sbjct:   191 MHSYQRHTGRQGQQDHHL-RILLLIVFVVVV 220




GO:0005634 "nucleus" evidence=ISM
GO:0008270 "zinc ion binding" evidence=IEA;ISS
TAIR|locus:2049023 AT2G23780 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037294 AT1G74990 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:1922078 Rnf185 "ring finger protein 185" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564777 Rnf185 "ring finger protein 185" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1977 rnf185 "ring finger protein 185" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZIR9 RNF185 "E3 ubiquitin-protein ligase RNF185" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PCX5 RNF185 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q96GF1 RNF185 "E3 ubiquitin-protein ligase RNF185" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4Y3 RNF185 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00021229
hypothetical protein (227 aa)
(Populus trichocarpa)
Predicted Functional Partners:
fgenesh4_pm.C_scaffold_86000046
hypothetical protein (276 aa)
       0.800
estExt_fgenesh4_pg.C_LG_VI0994
hypothetical protein (249 aa)
       0.800
estExt_Genewise1_v1.C_LG_XI1160
hypothetical protein (243 aa)
       0.800
estExt_Genewise1_v1.C_LG_IV1734
hypothetical protein (245 aa)
       0.800

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 3e-29
cd0016245 cd00162, RING, RING-finger (Really Interesting New 5e-12
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 7e-12
smart0018440 smart00184, RING, Ring finger 8e-10
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 1e-09
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 2e-09
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 3e-09
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 1e-07
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 2e-06
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 3e-06
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 5e-06
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 8e-04
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 0.001
pfam1286185 pfam12861, zf-Apc11, Anaphase-promoting complex su 0.004
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
 Score =  107 bits (269), Expect = 3e-29
 Identities = 46/97 (47%), Positives = 64/97 (65%), Gaps = 19/97 (19%)

Query: 26  AGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRE-------------CPVCK 72
            G+F+CNIC D  +DP+VTLCGHLFCWPC++KW +  +N R+             CPVCK
Sbjct: 16  GGDFDCNICLDQVRDPVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCK 75

Query: 73  ATIEEEKLVPLYGRGKSSTDPRSKSIPGVNIPNRPTG 109
           + + E  LVP+YGRG+ +  P+S    G N+P+RP+G
Sbjct: 76  SDVSEATLVPIYGRGQKA--PQS----GSNVPSRPSG 106


Length = 193

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>gnl|CDD|193335 pfam12861, zf-Apc11, Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 229
KOG0823230 consensus Predicted E3 ubiquitin ligase [Posttrans 99.97
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.94
KOG2164 513 consensus Predicted E3 ubiquitin ligase [Posttrans 99.41
KOG0317293 consensus Predicted E3 ubiquitin ligase, integral 99.36
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.33
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.21
KOG0320187 consensus Predicted E3 ubiquitin ligase [Posttrans 99.17
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.11
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.11
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.09
PHA02929238 N1R/p28-like protein; Provisional 99.04
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.99
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.96
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.96
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.91
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.87
PHA02926242 zinc finger-like protein; Provisional 98.81
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 98.81
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.77
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.74
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.72
PF1463444 zf-RING_5: zinc-RING finger domain 98.72
KOG0287 442 consensus Postreplication repair protein RAD18 [Re 98.67
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.63
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.54
KOG2177 386 consensus Predicted E3 ubiquitin ligase [Posttrans 98.51
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.47
KOG0802543 consensus E3 ubiquitin ligase [Posttranslational m 98.42
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.41
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.35
KOG0978698 consensus E3 ubiquitin ligase involved in syntaxin 98.26
KOG4265349 consensus Predicted E3 ubiquitin ligase [Posttrans 98.24
KOG417262 consensus Predicted E3 ubiquitin ligase [Posttrans 98.2
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.19
KOG0824 324 consensus Predicted E3 ubiquitin ligase [Posttrans 98.0
KOG4159 398 consensus Predicted E3 ubiquitin ligase [Posttrans 97.99
KOG0311 381 consensus Predicted E3 ubiquitin ligase [Posttrans 97.9
KOG1785563 consensus Tyrosine kinase negative regulator CBL [ 97.82
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.8
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.77
KOG0297 391 consensus TNF receptor-associated factor [Signal t 97.77
KOG1002791 consensus Nucleotide excision repair protein RAD16 97.75
KOG2660 331 consensus Locus-specific chromosome binding protei 97.75
KOG1734328 consensus Predicted RING-containing E3 ubiquitin l 97.74
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 97.74
COG5152259 Uncharacterized conserved protein, contains RING a 97.73
KOG2879298 consensus Predicted E3 ubiquitin ligase [Posttrans 97.72
KOG0828636 consensus Predicted E3 ubiquitin ligase [Posttrans 97.67
KOG1645 463 consensus RING-finger-containing E3 ubiquitin liga 97.61
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.54
KOG0826357 consensus Predicted E3 ubiquitin ligase involved i 97.53
KOG4692489 consensus Predicted E3 ubiquitin ligase [Posttrans 97.47
KOG1039344 consensus Predicted E3 ubiquitin ligase [Posttrans 97.41
KOG0827 465 consensus Predicted E3 ubiquitin ligase [Posttrans 97.39
COG52191525 Uncharacterized conserved protein, contains RING Z 97.36
COG5222427 Uncharacterized conserved protein, contains RING Z 97.32
KOG1813313 consensus Predicted E3 ubiquitin ligase [Posttrans 97.31
KOG3039303 consensus Uncharacterized conserved protein [Funct 97.27
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.17
KOG1571355 consensus Predicted E3 ubiquitin ligase [Posttrans 97.01
KOG4275350 consensus Predicted E3 ubiquitin ligase [Posttrans 96.95
KOG149384 consensus Anaphase-promoting complex (APC), subuni 96.82
KOG0825 1134 consensus PHD Zn-finger protein [General function 96.78
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 96.63
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 96.61
KOG1001674 consensus Helicase-like transcription factor HLTF/ 96.57
PF04641260 Rtf2: Rtf2 RING-finger 96.5
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.03
KOG2930114 consensus SCF ubiquitin ligase, Rbx1 component [Po 95.9
KOG4739233 consensus Uncharacterized protein involved in syna 95.75
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.74
KOG1941518 consensus Acetylcholine receptor-associated protei 95.46
KOG1814445 consensus Predicted E3 ubiquitin ligase [Posttrans 95.42
PHA03096284 p28-like protein; Provisional 95.27
KOG3970299 consensus Predicted E3 ubiquitin ligase [Posttrans 95.1
PHA02825162 LAP/PHD finger-like protein; Provisional 95.1
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 94.93
KOG4367 699 consensus Predicted Zn-finger protein [Function un 94.87
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 94.79
KOG4185296 consensus Predicted E3 ubiquitin ligase [Posttrans 94.77
KOG3002299 consensus Zn finger protein [General function pred 94.55
PHA02862156 5L protein; Provisional 94.4
KOG2817394 consensus Predicted E3 ubiquitin ligase [Posttrans 93.86
KOG4445368 consensus Uncharacterized conserved protein, conta 93.85
KOG4362 684 consensus Transcriptional regulator BRCA1 [Replica 93.82
KOG3800300 consensus Predicted E3 ubiquitin ligase containing 93.63
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 93.31
KOG02981394 consensus DEAD box-containing helicase-like transc 92.98
KOG1100207 consensus Predicted E3 ubiquitin ligase [Posttrans 92.85
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 92.8
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.69
KOG14283738 consensus Inhibitor of type V adenylyl cyclases/Ne 92.58
KOG2114933 consensus Vacuolar assembly/sorting protein PEP5/V 92.39
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 92.01
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 91.86
PF10272358 Tmpp129: Putative transmembrane protein precursor; 91.84
KOG3161 861 consensus Predicted E3 ubiquitin ligase [Posttrans 91.78
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 91.31
KOG3579352 consensus Predicted E3 ubiquitin ligase [Posttrans 91.17
KOG3268234 consensus Predicted E3 ubiquitin ligase [Posttrans 90.71
KOG3039303 consensus Uncharacterized conserved protein [Funct 90.34
KOG1952 950 consensus Transcription factor NF-X1, contains NFX 90.25
KOG1940276 consensus Zn-finger protein [General function pred 90.06
KOG2932 389 consensus E3 ubiquitin ligase involved in ubiquiti 89.78
COG5220314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.01
KOG3899381 consensus Uncharacterized conserved protein [Funct 88.19
KOG1815 444 consensus Predicted E3 ubiquitin ligase [Posttrans 87.63
KOG3053293 consensus Uncharacterized conserved protein [Funct 87.57
KOG2034911 consensus Vacuolar sorting protein PEP3/VPS18 [Int 87.23
COG5109396 Uncharacterized conserved protein, contains RING Z 84.25
KOG1812384 consensus Predicted E3 ubiquitin ligase [Posttrans 83.55
KOG0825 1134 consensus PHD Zn-finger protein [General function 83.01
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 82.63
KOG3113293 consensus Uncharacterized conserved protein [Funct 82.1
>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.97  E-value=3.1e-32  Score=231.63  Aligned_cols=178  Identities=43%  Similarity=0.865  Sum_probs=120.8

Q ss_pred             CCCCCccccccccCCCCcEEccCCCccChhHHHHHHhhCCCCCCCCCccccccccccccccCCCCC-CCCCCCCCCCCCC
Q 027010           24 SEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGRGKS-STDPRSKSIPGVN  102 (229)
Q Consensus        24 ~~~~~~~C~ICld~~~~pv~l~CgH~FC~~CL~~wl~~~s~~~~CPvCR~~v~~~~l~p~~~~~~~-~~d~~~~~~~~~~  102 (229)
                      .+...++|+||+|..+|||++.|||+|||.||++|++.+.+++.||+||..|+.++++|+|++++. .+++++++     
T Consensus        43 ~~~~~FdCNICLd~akdPVvTlCGHLFCWpClyqWl~~~~~~~~cPVCK~~Vs~~~vvPlYGrG~~~~~~~~~~~-----  117 (230)
T KOG0823|consen   43 RDGGFFDCNICLDLAKDPVVTLCGHLFCWPCLYQWLQTRPNSKECPVCKAEVSIDTVVPLYGRGSKKPSDPRKKD-----  117 (230)
T ss_pred             CCCCceeeeeeccccCCCEEeecccceehHHHHHHHhhcCCCeeCCccccccccceEEeeeccCCCCCCCccccc-----
Confidence            366789999999999999999999999999999999998889999999999999999999999984 55655554     


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCccCCCCcccCCCCCCcccccccccceeechhhc-------ccCcccccccccCCCCCCC
Q 027010          103 IPNRPTGQRPETAPPPEPSHFQHQHGFGFMGGLGGFAPMAAARFGNFTLSAAFG-------GLIPPLFNLQVHGFPDPTM  175 (229)
Q Consensus       103 ~p~Rps~~r~~~~~~~d~~~~~~~~~~~~~~~~~G~~~~~~~R~~~~~~s~~~g-------~~~~~~f~~~~~~~~~~~~  175 (229)
                      +|+||.++|.++.+..-.+.  ..++++...-..+....     -.+.+|+++|       ++||.+|...+.|.-    
T Consensus       118 vP~RP~~~R~e~~~p~~~~~--~~~g~r~~g~~~~~~~~-----~~f~~s~~i~~~~~~v~~~~p~~~~~~lf~~~----  186 (230)
T KOG0823|consen  118 VPPRPAGQRYESKRPTPQNR--GNHGFRFFGFRLGEESS-----NRFMYSFGIGLFGDPVMGLFPFGLYTRLFGTD----  186 (230)
T ss_pred             CCCCCCCccccccCCCCccc--cccccccccccccccCC-----cceeEEeecccCCCceeeeccccceeeecCCC----
Confidence            89999999987655421111  11233322111111000     1234444443       455555544433221    


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCC--CCCchHHHHHHHHHHHHHHHHHHHHHHhC
Q 027010          176 YGPAASFPYGFTNSFHGGHAHGYPQ--HTGQGQQDYYLKRLLLFIGFCVLLVLIWQ  229 (229)
Q Consensus       176 ~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~l~~~~~~~~~~~~~~l~~~  229 (229)
                          ..++ +       .+.+..+.  ..++.|+|++|+++|+|+++++++||+++
T Consensus       187 ----~~~~-~-------~~~~~~~~~~~~r~~q~e~~ls~~f~~~~~~~~~~l~~~  230 (230)
T KOG0823|consen  187 ----ETFP-A-------DTPRPSPARPLGRQMQRENSLSRVFLFLACFFVSWLLVI  230 (230)
T ss_pred             ----CCcc-c-------cCCCCCCCccccccchhhcccccchhhhhhhheeeeeeC
Confidence                1122 1       11122222  34555779999999999999999999864



>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0824 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms] Back     alignment and domain information
>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair] Back     alignment and domain information
>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown] Back     alignment and domain information
>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1645 consensus RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0827 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG2930 consensus SCF ubiquitin ligase, Rbx1 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4739 consensus Uncharacterized protein involved in synaptonemal complex formation [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1941 consensus Acetylcholine receptor-associated protein of the synapse (rapsyn) [Extracellular structures] Back     alignment and domain information
>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG3970 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4367 consensus Predicted Zn-finger protein [Function unknown] Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4185 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3002 consensus Zn finger protein [General function prediction only] Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2817 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown] Back     alignment and domain information
>KOG4362 consensus Transcriptional regulator BRCA1 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>KOG3800 consensus Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0298 consensus DEAD box-containing helicase-like transcription factor/DNA repair protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG3161 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG3579 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3268 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3039 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1952 consensus Transcription factor NF-X1, contains NFX-type Zn2+-binding and R3H domains [Transcription] Back     alignment and domain information
>KOG1940 consensus Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3899 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1815 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3053 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2034 consensus Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3113 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 2e-06
2ysl_A73 Solution Structure Of The Ring Domain (1-66) From T 2e-05
2ysj_A63 Solution Structure Of The Ring Domain (1-56) From T 7e-04
>pdb|1JM7|A Chain A, Solution Structure Of The Brca1/bard1 Ring-domain Heterodimer Length = 112 Back     alignment and structure

Iteration: 1

Score = 49.3 bits (116), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 22/61 (36%), Positives = 33/61 (54%) Query: 20 NNSNSEAGNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEK 79 N N+ EC IC +L ++P+ T C H+FC C+ K L+ +CP+CK I + Sbjct: 13 NVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRS 72 Query: 80 L 80 L Sbjct: 73 L 73
>pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 Back     alignment and structure
>pdb|2YSJ|A Chain A, Solution Structure Of The Ring Domain (1-56) From Tripartite Motif-containing Protein 31 Length = 63 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query229
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-21
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 5e-19
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 8e-19
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 8e-19
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 3e-18
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 4e-18
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-16
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 7e-16
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 8e-16
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-14
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 8e-14
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 1e-13
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-13
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 5e-13
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-12
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 2e-12
2ysl_A73 Tripartite motif-containing protein 31; ring-type 3e-12
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-12
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 2e-11
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-11
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-11
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-11
1z6u_A150 NP95-like ring finger protein isoform B; structura 9e-11
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 1e-10
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 2e-10
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 2e-10
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 2e-10
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-10
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-10
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 2e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 5e-10
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-09
2ysj_A63 Tripartite motif-containing protein 31; ring-type 5e-10
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 2e-09
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 3e-09
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-09
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 1e-08
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 3e-08
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 3e-08
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 7e-08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 2e-07
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 5e-07
3nw0_A238 Non-structural maintenance of chromosomes element 5e-07
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 7e-07
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 8e-07
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 3e-06
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-06
2ect_A78 Ring finger protein 126; metal binding protein, st 3e-06
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 4e-06
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 7e-06
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 1e-05
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 2e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-05
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 3e-05
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 3e-05
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 3e-05
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 4e-05
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 5e-05
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 6e-05
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 8e-05
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 2e-04
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 3e-04
2f42_A179 STIP1 homology and U-box containing protein 1; cha 3e-04
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 4e-04
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 5e-04
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 8e-04
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 83.8 bits (207), Expect = 3e-21
 Identities = 19/78 (24%), Positives = 32/78 (41%), Gaps = 3/78 (3%)

Query: 8  STSRSAQNPYSNNNSNSEAGNFECNICFDLAQDP-IVTLCGHLFCWPCLYKWLHGHSNYR 66
                 +     +  S A  F C IC +  +D  +   C  L C+ C+ +WL       
Sbjct: 2  GHHHHHHSHMDEQSVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRA-- 59

Query: 67 ECPVCKATIEEEKLVPLY 84
          +CP C+A ++  +LV   
Sbjct: 60 QCPHCRAPLQLRELVNCR 77


>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Length = 61 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 94 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Length = 100 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Length = 968 Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Length = 93 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Length = 179 Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Length = 78 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.58
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.55
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.55
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.54
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.53
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.51
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.51
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.51
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.51
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.49
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.49
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.49
2ect_A78 Ring finger protein 126; metal binding protein, st 99.48
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.48
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.48
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.46
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.46
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.44
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.43
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.41
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.41
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.4
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.4
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.38
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.37
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.37
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.36
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.36
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.36
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.34
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.33
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.33
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.32
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.31
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.31
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.3
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.29
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.29
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.29
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.28
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.27
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.26
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.26
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.22
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.22
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.21
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.2
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.2
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.2
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.2
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.19
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.18
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.14
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.13
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.13
2ea5_A68 Cell growth regulator with ring finger domain prot 99.1
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.08
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.07
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.06
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.04
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.03
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.0
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.94
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.83
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.83
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.79
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.76
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.67
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.35
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.3
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.85
3nw0_A238 Non-structural maintenance of chromosomes element 97.06
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 96.46
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.3
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 96.17
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.68
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 89.26
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 88.27
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 87.59
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 86.76
1weu_A91 Inhibitor of growth family, member 4; structural g 86.7
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 85.52
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 85.18
1wem_A76 Death associated transcription factor 1; structura 83.74
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 83.62
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 82.39
2k16_A75 Transcription initiation factor TFIID subunit 3; p 82.06
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.58  E-value=3.1e-15  Score=105.42  Aligned_cols=62  Identities=21%  Similarity=0.460  Sum_probs=52.0

Q ss_pred             CCCCCCCCCccccccccCCCCcEEc-cCCCccChhHHHHHHhhCCCCCCCCCcccccccccccccc
Q 027010           20 NNSNSEAGNFECNICFDLAQDPIVT-LCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLY   84 (229)
Q Consensus        20 ~~~~~~~~~~~C~ICld~~~~pv~l-~CgH~FC~~CL~~wl~~~s~~~~CPvCR~~v~~~~l~p~~   84 (229)
                      .+.+..++++.|+||++.+.+|+++ +|||.||..||.+|++.+   ..||+||+.+..+++.++.
T Consensus         7 ~~~~~~~~~~~C~IC~~~~~~p~~~~~CgH~fC~~Ci~~~~~~~---~~CP~Cr~~~~~~~~~~~~   69 (72)
T 2djb_A            7 GNLSELTPYILCSICKGYLIDATTITECLHTFCKSCIVRHFYYS---NRCPKCNIVVHQTQPLSGP   69 (72)
T ss_dssp             CCCCCCCGGGSCTTTSSCCSSCEECSSSCCEECHHHHHHHHHHC---SSCTTTCCCCCSSCSCCCC
T ss_pred             hhHhhcCCCCCCCCCChHHHCcCEECCCCCHHHHHHHHHHHHcC---CcCCCcCcccCcccccccC
Confidence            3445566789999999999999987 999999999999999854   5999999999876665543



>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 229
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-18
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-14
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-14
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 3e-13
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-10
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-10
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 8e-10
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 1e-08
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 6e-08
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 8e-08
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 2e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 5e-07
d2c2la280 g.44.1.2 (A:225-304) STIP1 homology and U box-cont 6e-07
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 6e-07
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 5e-05
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 2e-04
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 73.9 bits (181), Expect = 7e-18
 Identities = 20/55 (36%), Positives = 30/55 (54%)

Query: 28 NFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVP 82
            EC IC +L ++P+ T C H+FC  C+ K L+      +CP+CK  I +  L  
Sbjct: 21 ILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQE 75


>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query229
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.49
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.47
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.46
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.46
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.46
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.42
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.35
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.31
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.3
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.28
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.26
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.24
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.16
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.06
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.93
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.39
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 94.34
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 90.73
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 90.64
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 90.15
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 88.84
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 86.94
d1wema_76 Death associated transcription factor 1, Datf1 (DI 86.94
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: brca1 RING domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.49  E-value=9.1e-15  Score=108.65  Aligned_cols=60  Identities=33%  Similarity=0.760  Sum_probs=51.3

Q ss_pred             CCccccccccCCCCcEEccCCCccChhHHHHHHhhCCCCCCCCCccccccccccccccCC
Q 027010           27 GNFECNICFDLAQDPIVTLCGHLFCWPCLYKWLHGHSNYRECPVCKATIEEEKLVPLYGR   86 (229)
Q Consensus        27 ~~~~C~ICld~~~~pv~l~CgH~FC~~CL~~wl~~~s~~~~CPvCR~~v~~~~l~p~~~~   86 (229)
                      +.++|+||++.+.+|+.++|||.||..||.+|++.+.....||+||..+..+.+.+++..
T Consensus        20 ~~l~CpIC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~~~~CP~Cr~~~~~~~l~~n~~l   79 (103)
T d1jm7a_          20 KILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQCPLCKNDITKRSLQESTRF   79 (103)
T ss_dssp             HHTSCSSSCCCCSSCCBCTTSCCCCSHHHHHHHHSSSSSCCCTTTSCCCCTTTCBCCCSS
T ss_pred             cCcCCCccCchhCCeEEcCCCCchhhHHHHHHHHHCCCCCcCcCCCCcCChhhCCcCHHH
Confidence            457899999999999999999999999999999865555689999999887776665543



>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure