BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027013
         (229 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3FWY|A Chain A, Crystal Structure Of The L Protein Of Rhodobacter
           Sphaeroides Light- Independent Protochlorophyllide
           Reductase (Bchl) With Mgadp Bound: A Homologue Of The
           Nitrogenase Fe Protein
 pdb|3FWY|B Chain B, Crystal Structure Of The L Protein Of Rhodobacter
           Sphaeroides Light- Independent Protochlorophyllide
           Reductase (Bchl) With Mgadp Bound: A Homologue Of The
           Nitrogenase Fe Protein
          Length = 314

 Score = 31.6 bits (70), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 29/59 (49%)

Query: 48  VYALLNCLITMWYGTPLVSADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLL 106
           ++ +L  ++   +  PL  AD  +V T N   + + +  II  +    K+ KVR+ G +
Sbjct: 168 IFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCV 226


>pdb|2YNM|A Chain A, Structure Of The Adpxalf3-stabilized Transition State Of
           The Nitrogenase-like Dark-operative Protochlorophyllide
           Oxidoreductase Complex From Prochlorococcus Marinus With
           Its Substrate Protochlorophyllide A
 pdb|2YNM|B Chain B, Structure Of The Adpxalf3-stabilized Transition State Of
           The Nitrogenase-like Dark-operative Protochlorophyllide
           Oxidoreductase Complex From Prochlorococcus Marinus With
           Its Substrate Protochlorophyllide A
          Length = 301

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/59 (25%), Positives = 30/59 (50%)

Query: 48  VYALLNCLITMWYGTPLVSADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLL 106
           ++ +L  ++   +  PL  A+  L+ T N   + F +  I+  I    K+ KVR+ G++
Sbjct: 154 IFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVI 212


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.145    0.438 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,625,917
Number of Sequences: 62578
Number of extensions: 193901
Number of successful extensions: 355
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 353
Number of HSP's gapped (non-prelim): 2
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)