BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027013
(229 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3FWY|A Chain A, Crystal Structure Of The L Protein Of Rhodobacter
Sphaeroides Light- Independent Protochlorophyllide
Reductase (Bchl) With Mgadp Bound: A Homologue Of The
Nitrogenase Fe Protein
pdb|3FWY|B Chain B, Crystal Structure Of The L Protein Of Rhodobacter
Sphaeroides Light- Independent Protochlorophyllide
Reductase (Bchl) With Mgadp Bound: A Homologue Of The
Nitrogenase Fe Protein
Length = 314
Score = 31.6 bits (70), Expect = 0.37, Method: Compositional matrix adjust.
Identities = 15/59 (25%), Positives = 29/59 (49%)
Query: 48 VYALLNCLITMWYGTPLVSADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLL 106
++ +L ++ + PL AD +V T N + + + II + K+ KVR+ G +
Sbjct: 168 IFDVLGDVVCGGFAAPLQHADQAVVVTANDFDSIYAMNRIIAAVQAKSKNYKVRLAGCV 226
>pdb|2YNM|A Chain A, Structure Of The Adpxalf3-stabilized Transition State Of
The Nitrogenase-like Dark-operative Protochlorophyllide
Oxidoreductase Complex From Prochlorococcus Marinus With
Its Substrate Protochlorophyllide A
pdb|2YNM|B Chain B, Structure Of The Adpxalf3-stabilized Transition State Of
The Nitrogenase-like Dark-operative Protochlorophyllide
Oxidoreductase Complex From Prochlorococcus Marinus With
Its Substrate Protochlorophyllide A
Length = 301
Score = 29.3 bits (64), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 15/59 (25%), Positives = 30/59 (50%)
Query: 48 VYALLNCLITMWYGTPLVSADNILVTTVNSIGAAFQLVYIILFITYTEKDKKVRMLGLL 106
++ +L ++ + PL A+ L+ T N + F + I+ I K+ KVR+ G++
Sbjct: 154 IFDVLGDVVCGGFAAPLQHANYCLIVTANDFDSIFAMNRIVAAINAKAKNYKVRLGGVI 212
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.331 0.145 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,625,917
Number of Sequences: 62578
Number of extensions: 193901
Number of successful extensions: 355
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 353
Number of HSP's gapped (non-prelim): 2
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)