BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027066
         (229 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3V0A|B Chain B, 2.7 Angstrom Crystal Structure Of BontAI IN COMPLEX WITH
           NTNHA
 pdb|3V0B|B Chain B, 3.9 Angstrom Crystal Structure Of BontAI IN COMPLEX WITH
           NTNHA
          Length = 1196

 Score = 30.4 bits (67), Expect = 0.92,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 31/59 (52%), Gaps = 4/59 (6%)

Query: 36  HSILYIHKFFENYLSFSGSLIFWVFL----CLKAKVVPDQYDEMTYCVYSTDASTVYGL 90
            SI + + FFEN L+ S S+ FW+       +K+K++  + D   + +Y  D   V+ +
Sbjct: 887 QSISFSNDFFENGLTNSFSIYFWLRNLGKDTIKSKLIGSKEDNCGWEIYFQDTGLVFNM 945


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.327    0.137    0.436 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,134,188
Number of Sequences: 62578
Number of extensions: 215709
Number of successful extensions: 523
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 523
Number of HSP's gapped (non-prelim): 2
length of query: 229
length of database: 14,973,337
effective HSP length: 95
effective length of query: 134
effective length of database: 9,028,427
effective search space: 1209809218
effective search space used: 1209809218
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 50 (23.9 bits)