BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027087
(228 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein
Kinase 6 (Mapk6)
pdb|2I6L|B Chain B, Crystal Structure Of Human Mitogen Activated Protein
Kinase 6 (Mapk6)
Length = 320
Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 7/47 (14%)
Query: 163 LKGYPEVHAALA-------AALYVDKHALLLAENQFTIATLLDPHYT 202
L+G +H+A A L+++ L+L F +A ++DPHY+
Sbjct: 130 LRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYS 176
>pdb|1JF4|A Chain A, Crystal Structure Of Component Iv Glycera Dibranchiata
Monomeric Hemoglobin
pdb|1JL6|A Chain A, Crystal Structure Of Cn-Ligated Component Iv Glycera
Dibranchiata Monomeric Hemoglobin
pdb|1VRF|A Chain A, Solution Structure Of Component Iv Glycera Dibranchiata
Monomeric Hemoglobin-Co
pdb|1VRE|A Chain A, Solution Structure Of Component Iv Glycera Dibranchiata
Monomeric Hemoglobin-Co
Length = 147
Score = 27.7 bits (60), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
Query: 128 DFAFSEYARVGRALALYEVGDREEAIAEMEDVSISLKGYPEVH 170
D A++G +A+ +GD + +AEM+ V + KGY H
Sbjct: 57 DLGAKVLAQIG--VAVSHLGDEGKMVAEMKAVGVRHKGYGNKH 97
>pdb|2WVX|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
Length = 744
Score = 26.9 bits (58), Expect = 8.7, Method: Composition-based stats.
Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
Query: 97 LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
++ +KG ++ I + NK + Y T V EN+K++ E+ + A E G+ +E
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVEQGNLQEN 203
Query: 153 IAE 155
+AE
Sbjct: 204 VAE 206
>pdb|2WZS|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
pdb|2WZS|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Mannoimidazole
Length = 738
Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats.
Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
Query: 97 LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
++ +KG ++ I + NK + Y T V EN+K++ E+ + A E G+ +E
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVENGNLQEN 203
Query: 153 IAE 155
+AE
Sbjct: 204 VAE 206
>pdb|2WVZ|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WVZ|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WVZ|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WVZ|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW0|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482
pdb|2WW1|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW1|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW1|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW1|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
pdb|2WW3|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
With Thiomannobioside
Length = 744
Score = 26.9 bits (58), Expect = 8.9, Method: Composition-based stats.
Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)
Query: 97 LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
++ +KG ++ I + NK + Y T V EN+K++ E+ + A E G+ +E
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVENGNLQEN 203
Query: 153 IAE 155
+AE
Sbjct: 204 VAE 206
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.131 0.369
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,379,372
Number of Sequences: 62578
Number of extensions: 171372
Number of successful extensions: 390
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 387
Number of HSP's gapped (non-prelim): 10
length of query: 228
length of database: 14,973,337
effective HSP length: 95
effective length of query: 133
effective length of database: 9,028,427
effective search space: 1200780791
effective search space used: 1200780791
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)