BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027087
         (228 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein
           Kinase 6 (Mapk6)
 pdb|2I6L|B Chain B, Crystal Structure Of Human Mitogen Activated Protein
           Kinase 6 (Mapk6)
          Length = 320

 Score = 28.5 bits (62), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 25/47 (53%), Gaps = 7/47 (14%)

Query: 163 LKGYPEVHAALA-------AALYVDKHALLLAENQFTIATLLDPHYT 202
           L+G   +H+A         A L+++   L+L    F +A ++DPHY+
Sbjct: 130 LRGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLARIMDPHYS 176


>pdb|1JF4|A Chain A, Crystal Structure Of Component Iv Glycera Dibranchiata
           Monomeric Hemoglobin
 pdb|1JL6|A Chain A, Crystal Structure Of Cn-Ligated Component Iv Glycera
           Dibranchiata Monomeric Hemoglobin
 pdb|1VRF|A Chain A, Solution Structure Of Component Iv Glycera Dibranchiata
           Monomeric Hemoglobin-Co
 pdb|1VRE|A Chain A, Solution Structure Of Component Iv Glycera Dibranchiata
           Monomeric Hemoglobin-Co
          Length = 147

 Score = 27.7 bits (60), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 2/43 (4%)

Query: 128 DFAFSEYARVGRALALYEVGDREEAIAEMEDVSISLKGYPEVH 170
           D      A++G  +A+  +GD  + +AEM+ V +  KGY   H
Sbjct: 57  DLGAKVLAQIG--VAVSHLGDEGKMVAEMKAVGVRHKGYGNKH 97


>pdb|2WVX|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
          Length = 744

 Score = 26.9 bits (58), Expect = 8.7,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 97  LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
           ++  +KG  ++ I + NK + Y T     V EN+K++   E+ +     A  E G+ +E 
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVEQGNLQEN 203

Query: 153 IAE 155
           +AE
Sbjct: 204 VAE 206


>pdb|2WZS|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
 pdb|2WZS|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Mannoimidazole
          Length = 738

 Score = 26.9 bits (58), Expect = 8.9,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 97  LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
           ++  +KG  ++ I + NK + Y T     V EN+K++   E+ +     A  E G+ +E 
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVENGNLQEN 203

Query: 153 IAE 155
           +AE
Sbjct: 204 VAE 206


>pdb|2WVZ|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WVZ|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|G Chain G, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW0|H Chain H, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482
 pdb|2WW1|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW1|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|A Chain A, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|B Chain B, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|C Chain C, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|D Chain D, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|E Chain E, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
 pdb|2WW3|F Chain F, Structure Of The Family Gh92 Inverting Mannosidase Bt3990
           From Bacteroides Thetaiotaomicron Vpi-5482 In Complex
           With Thiomannobioside
          Length = 744

 Score = 26.9 bits (58), Expect = 8.9,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 97  LELLEKGRELQAIGDFNKALQYFTL----VVENYKDFAFSEYARVGRALALYEVGDREEA 152
           ++  +KG  ++ I + NK + Y T     V EN+K++   E+ +     A  E G+ +E 
Sbjct: 144 VDAFDKGSYIKIIPEENKIIGYTTRNSGGVPENFKNYFIIEFDKPFTYKATVENGNLQEN 203

Query: 153 IAE 155
           +AE
Sbjct: 204 VAE 206


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.131    0.369 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,379,372
Number of Sequences: 62578
Number of extensions: 171372
Number of successful extensions: 390
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 387
Number of HSP's gapped (non-prelim): 10
length of query: 228
length of database: 14,973,337
effective HSP length: 95
effective length of query: 133
effective length of database: 9,028,427
effective search space: 1200780791
effective search space used: 1200780791
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)