Citrus Sinensis ID: 027088


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MLYIIGLGLGDERDITLRGLEAVKKCDKVYIEAYTSLLSFGLSTDGLSTLEKLYGKPIALADREMVEEKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQTS
cEEEEcccccccccccHHHHHHHHHccEEEEcccccccccccccccHHHHHHHHccccccccHHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHcccccccccEEEEEECccccccccHHHHHHHHHHccccEEEEEEEEcccccHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEEEcccc
MLYIIGLGLGDERDITLRGLEAVKKCDKVYIEAYTSLLSFGLSTDGLSTLEKLYGKPIALADREMVEEKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLYIIGLGLGDERDITLRGLEAVKKCDKVYIEAYTSLLSFGLSTDGLSTLEKLYGKPIALADREMVEEKADKILSESQESNVAFLVVGDPFGATTHTDLVVRAKKLGIQVKAVHNASVMNAVGICGLQLYRFGETVSIPFFTETWRPGSFYEKIKRNRSLGLHTLCLLDIRVKEPSLESLCRGKKLYEPPRYMTVNIAIEQLLEVELLQGESGKAHELKIILKQLQTS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.probableO81769
Diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.probableQ6CIZ1
Diphthine synthase S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the trimethylation of the amino group of the modified target histidine residue in translation elongation factor 2 (EF-2), to form an intermediate called diphthine. The three successive methylation reactions represent the second step of diphthamide biosynthesis.probableQ9CWQ0

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.1.-.-Transferring one-carbon groups.probable
2.1.1.-15-hydroxyprostaglandin-I dehydrogenase (NADP(+)).probable
2.1.1.98Diphthine synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I4T, chain A
Confidence level:very confident
Coverage over the Query: 1-174,188-226
View the alignment between query and template
View the model in PyMOL