BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 027101
(228 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2VKD|A Chain A, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Manganese Ion
pdb|2VKD|B Chain B, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Manganese Ion
pdb|2VKD|C Chain C, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Manganese Ion
pdb|2VKH|A Chain A, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Calcium Ion
pdb|2VKH|B Chain B, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Calcium Ion
pdb|2VKH|C Chain C, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp-glc And
Calcium Ion
pdb|2VL8|A Chain A, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp,
Castanospermine And Calcium Ion
pdb|2VL8|B Chain B, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp,
Castanospermine And Calcium Ion
pdb|2VL8|C Chain C, Crystal Structure Of The Catalytic Domain Of Lethal Toxin
From Clostridium Sordellii In Complex With Udp,
Castanospermine And Calcium Ion
Length = 546
Score = 27.3 bits (59), Expect = 7.7, Method: Compositional matrix adjust.
Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 7/55 (12%)
Query: 57 GHHMLDFKTSERKKKIRKFNESAWKCVYFLTAELLALSVTYDEPWFKNTRCFWVG 111
+++ +K S R K ++KF E +LT E+L L P KN W+G
Sbjct: 57 DNYLNTYKKSGRNKALKKFKE-------YLTMEVLELKNNSLTPVEKNLHFIWIG 104
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.329 0.142 0.468
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,137,737
Number of Sequences: 62578
Number of extensions: 273439
Number of successful extensions: 582
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 578
Number of HSP's gapped (non-prelim): 14
length of query: 228
length of database: 14,973,337
effective HSP length: 95
effective length of query: 133
effective length of database: 9,028,427
effective search space: 1200780791
effective search space used: 1200780791
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)