BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 027109
         (228 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LGV|A Chain A, Rbx1
          Length = 100

 Score = 28.1 bits (61), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 20/80 (25%), Positives = 31/80 (38%), Gaps = 7/80 (8%)

Query: 137 RFSSLVTNAASPDTVKIV---CGICQKLLRRKSHLLGMGSTIPSGEQHAVAVLVCGHVYH 193
           RF    +NA++     IV   C IC+  +              + E+  VA  VC H +H
Sbjct: 13  RFEVKKSNASAQSAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFH 72

Query: 194 ADCLEQRTSAEDIRDPPCPL 213
             C+ +      +    CPL
Sbjct: 73  FHCISRWLKTRQV----CPL 88


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.390 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,422,622
Number of Sequences: 62578
Number of extensions: 234723
Number of successful extensions: 583
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 576
Number of HSP's gapped (non-prelim): 14
length of query: 228
length of database: 14,973,337
effective HSP length: 95
effective length of query: 133
effective length of database: 9,028,427
effective search space: 1200780791
effective search space used: 1200780791
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)