Citrus Sinensis ID: 027123

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------23
MSVEARTGRLRQRYDNNFRLVSGCIPYRLTKDAEDENEDTQTRIEVLMVSSPNRSDLVFPKGGWENDETVMEAACREALEEAGVRGKLNEKPLGIWEFRSKSKQDLHSLEGGCRGYMFSLEVTEELEIWPEQENRYRKWLNIQDAFQLCRYEWMREALEKFMKVMSEEQKVEITEEIVEPLPKPVPDVIAECQIVSSNYCVTTTSSQHHGISAIIPFHWQILKRLPLT
ccccccccccccccccccEEEEEEEEEEEccccccccccccccEEEEEEEccccccEEEccccccccccHHHHHHHHHHHHHcccccccccccCEEEEEEccccccccccccEEEEEEEEEEEHHHcccccccccEEEEEEHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHcccccccccccccccccccccccHHHHHHHHccccc
***********QRYDNNFRLVSGCIPYRLTKDAEDENEDTQTRIEVLMVSSPNRSDLVFPKGGWENDETVMEAACREALEEAGVRGKLNEKPLGIWEFRSKSKQDLHSLEGGCRGYMFSLEVTEELEIWPEQENRYRKWLNIQDAFQLCRYEWMREALEKFMKVMSEEQ***********LPKPVPDVIA*CQIVSSNYCV*TTSSQHHGISAIIPFHWQILKRLPL*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVEARTGRLRQRYDNNFRLVSGCIPYRLTKDAEDENEDTQTRIEVLMVSSPNRSDLVFPKGGWENDETVMEAACREALEEAGVRGKLNEKPLGIWEFRSKSKQDLHSLEGGCRGYMFSLEVTEELEIWPEQENRYRKWLNIQDAFQLCRYEWMREALEKFMKVMSEEQKVEITEEIVEPLPKPVPDVIAECQIVSSNYCVTTTSSQHHGISAIIPFHWQILKRLPLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nudix hydrolase 13, mitochondrial Mediates the hydrolysis of some nucleoside diphosphate derivatives. Can use diadenosine 5',5'''-P(1)P(6) hexaphosphate (Ap(6)A), diadenosine 5',5'''-P(1)P(5) pentaphosphate (Ap(5)A) and adenosine tetraphosphate (p(4)A) as substrates, but not diadenosine 5',5'''-P(1)P(4) tetraphosphate (Ap(4)A), diadenosine 5',5'''-P(1)P(3) triphosphate (Ap(3)A), deoxyribonucleoside triphosphates, ribonucleoside triphosphates, diphosphoinositol pentakisphosphate (PP-InsP(5)) and 5-phospho-alpha-D-ribosyl diphosphate (PRPP).probableQ52K88

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FVV, chain A
Confidence level:very confident
Coverage over the Query: 16-31,43-101,112-164
View the alignment between query and template
View the model in PyMOL
Template: 3FJY, chain A
Confidence level:very confident
Coverage over the Query: 19-97,114-169
View the alignment between query and template
View the model in PyMOL